DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and AT3G13224

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_683559.2 Gene:AT3G13224 / 820515 AraportID:AT3G13224 Length:358 Species:Arabidopsis thaliana


Alignment Length:240 Identity:56/240 - (23%)
Similarity:101/240 - (42%) Gaps:41/240 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RQSEDNLENSTAKTKRTEAHLRCFDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSK 148
            |...||.::....:..        .:.:.||..:||.....::|..||::..:.|.:|..:|..:
plant     4 RSRNDNFQSGDGASPG--------KIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPR 60

  Fly   149 GFGFVRFGSYDVQMHVLSKRHSIDGRWCEVK--VPASRGMGNQ----EPGKVFVGRCTEDIEADD 207
            ||||:.|....|...|:...|.|:|:..|:|  :|...| |||    :..|:|||.....:..|:
plant    61 GFGFITFADPSVVDKVIEDTHVINGKQVEIKRTIPKGAG-GNQSKDIKTKKIFVGGIPSTVTEDE 124

  Fly   208 LREYFSKFGEVIDVFIPKPF-----RAFSFVTFLDPYVPRVVCGEKHII--KGVSVHVSTADKKN 265
            |:::|:|:|.|::..:.:..     |.|.||.|....|...:..:.::|  ....|.:..|:.|.
plant   125 LKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPKK 189

  Fly   266 VQNKNQLFQTNNYNNLDNNFKMQPANNFRMHPANNFSMHSFNPHG 310
            ..|::                   ..::..||....|..|:..:|
plant   190 SLNRS-------------------PPSYGSHPRGRSSNDSYASYG 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 22/74 (30%)
RRM2_TDP43 193..262 CDD:409761 18/75 (24%)
AT3G13224NP_683559.2 RRM_SF 21..91 CDD:473069 21/69 (30%)
RRM_SF 110..188 CDD:473069 19/77 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.