DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and AT3G13224

DIOPT Version :9

Sequence 1:NP_001261874.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_683559.2 Gene:AT3G13224 / 820515 AraportID:AT3G13224 Length:358 Species:Arabidopsis thaliana


Alignment Length:240 Identity:56/240 - (23%)
Similarity:101/240 - (42%) Gaps:41/240 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RQSEDNLENSTAKTKRTEAHLRCFDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSK 148
            |...||.::....:..        .:.:.||..:||.....::|..||::..:.|.:|..:|..:
plant     4 RSRNDNFQSGDGASPG--------KIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPR 60

  Fly   149 GFGFVRFGSYDVQMHVLSKRHSIDGRWCEVK--VPASRGMGNQ----EPGKVFVGRCTEDIEADD 207
            ||||:.|....|...|:...|.|:|:..|:|  :|...| |||    :..|:|||.....:..|:
plant    61 GFGFITFADPSVVDKVIEDTHVINGKQVEIKRTIPKGAG-GNQSKDIKTKKIFVGGIPSTVTEDE 124

  Fly   208 LREYFSKFGEVIDVFIPKPF-----RAFSFVTFLDPYVPRVVCGEKHII--KGVSVHVSTADKKN 265
            |:::|:|:|.|::..:.:..     |.|.||.|....|...:..:.::|  ....|.:..|:.|.
plant   125 LKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPKK 189

  Fly   266 VQNKNQLFQTNNYNNLDNNFKMQPANNFRMHPANNFSMHSFNPHG 310
            ..|::                   ..::..||....|..|:..:|
plant   190 SLNRS-------------------PPSYGSHPRGRSSNDSYASYG 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_001261874.1 RRM1_TDP43 108..184 CDD:240767 23/77 (30%)
RRM2_TDP43 193..262 CDD:240768 18/75 (24%)
AT3G13224NP_683559.2 RRM_SF 21..91 CDD:418427 21/69 (30%)
RRM_SF 110..188 CDD:418427 19/77 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48033
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.