DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and NCL

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_005372.2 Gene:NCL / 4691 HGNCID:7667 Length:710 Species:Homo sapiens


Alignment Length:268 Identity:65/268 - (24%)
Similarity:113/268 - (42%) Gaps:75/268 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SEKEGDE--------PIELPAEEDGTLLLSTLQAQFPESSGLQYRNVDTKAVRGVRSNEGRLYSP 63
            |:||.|.        |.::..:|        |:..|.:::.::..:.|.|: :|:...|.:..:.
Human   386 SKKERDARTLLAKNLPYKVTQDE--------LKEVFEDAAEIRLVSKDGKS-KGIAYIEFKTEAD 441

  Fly    64 SEETGWGEYHYFCVFPKK----------------NKRQSED--NLENST----AKTKRTEAHLRC 106
            :|:|          |.:|                .|.|::|  ..:|||    :||         
Human   442 AEKT----------FEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSGESKT--------- 487

  Fly   107 FDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKK--DTRSGHSKGFGFVRFGSYDVQMHVLS--K 167
              |::..|||:.||:.|:|.||      ||...|  ..::|.|||:.|:.|.|::.....|:  .
Human   488 --LVLSNLSYSATEETLQEVFE------KATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCN 544

  Fly   168 RHSIDGRWCEVKVPASRGMGN--QEPGK-VFVGRCTEDIEADDLREYF--SKFGEVIDVFIPKPF 227
            :..|:||...:::...||..|  .:|.| :||...:||...:.|:|.|  |....::........
Human   545 KREIEGRAIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSS 609

  Fly   228 RAFSFVTF 235
            :.|.||.|
Human   610 KGFGFVDF 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833 14/78 (18%)
RRM1_TDP43 108..181 CDD:409760 24/76 (32%)
RRM2_TDP43 193..262 CDD:409761 13/46 (28%)
NCLNP_005372.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..303
8 X 8 AA tandem repeats of X-T-P-X-K-K-X-X 58..135
RRM1_NCL 307..381 CDD:409837
RRM2_NCL 390..465 CDD:409838 13/93 (14%)
RRM3_NCL 485..557 CDD:409839 26/88 (30%)
RRM4_NCL 572..649 CDD:409840 13/46 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 640..710
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.