DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and mod

DIOPT Version :9

Sequence 1:NP_001261874.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001247401.1 Gene:mod / 43764 FlyBaseID:FBgn0002780 Length:542 Species:Drosophila melanogaster


Alignment Length:289 Identity:72/289 - (24%)
Similarity:104/289 - (35%) Gaps:88/289 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSEKEGDE--PIELP------------AEED--------GTLLLST------------------- 29
            |.|.:.||  |:|.|            :||:        |.:.|.|                   
  Fly   126 VDESDDDEEAPVEKPVSKKSEKANSEKSEENRGIPKVKVGKIPLGTPKNQIVFVTNLPNEYLHKD 190

  Fly    30 ---LQAQFPESSGLQ-YRNVDTKAVRGVRSNEGRLYSPSEETGWGEYHYFCVFPKKNKRQS-EDN 89
               |.|:|...|.|| :.|::        .|:..|.:....|| .|    .|...|.|..: .||
  Fly   191 LVALFAKFGRLSALQRFTNLN--------GNKSVLIAFDTSTG-AE----AVLQAKPKALTLGDN 242

  Fly    90 LENSTAKTKRTEAHLRCFDLIVLGL-SYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFV 153
            :.:.:....:.|.:.|   .:|:|| ..|.|:.||:.:||....|....|.    |.......||
  Fly   243 VLSVSQPRNKEENNER---TVVVGLIGPNITKDDLKTFFEKVAPVEAVTIS----SNRLMPRAFV 300

  Fly   154 RFGSYDVQMHVLSKRHSID--GRWCEVKVPASRGMGN--------QEPGKVFVGRCTEDIEADDL 208
            |..|.|.....| |.||.:  .|:..|:..:...:..        :..||      .|...:|.|
  Fly   301 RLASVDDIPKAL-KLHSTELFSRFITVRRISQESISRTSELTLVVENVGK------HESYSSDAL 358

  Fly   209 REYFSKFGEV--IDVFIPKPFRAFSFVTF 235
            .:.|.|||:|  |||...|  ...:||||
  Fly   359 EKIFKKFGDVEEIDVVCSK--AVLAFVTF 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_001261874.1 RRM1_TDP43 108..184 CDD:240767 23/78 (29%)
RRM2_TDP43 193..262 CDD:240768 17/45 (38%)
modNP_001247401.1 RRM_SF 177..244 CDD:302621 17/79 (22%)
RRM_SF 260..327 CDD:240668 22/71 (31%)
RRM_SF 342..411 CDD:240668 18/52 (35%)
RRM_SF 422..>465 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439639
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.