DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and trv

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster


Alignment Length:158 Identity:42/158 - (26%)
Similarity:68/158 - (43%) Gaps:37/158 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 FDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRF--------------GS 157
            |.:.|..||.....|.|||.|..:|::....:.:|.::..|||:|||.|              |.
  Fly   312 FHIFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQ 376

  Fly   158 YDVQMHVLSKRHSIDGRWCEVKVPASR---------GMGNQ-EPGK--VFVGRCTEDIEA---DD 207
            :      |..| ||...|...|.|||:         .:.|| .|..  |:||.....:.|   :.
  Fly   377 W------LGSR-SIRTNWATRKPPASKENIKPLTFDEVYNQSSPSNCTVYVGGVNSALTALSEEV 434

  Fly   208 LREYFSKFGEVIDVFIPKPFRAFSFVTF 235
            |::.|:.:|.:.::.:.|. :.::||.|
  Fly   435 LQKTFAPYGAIQEIRVFKD-KGYAFVRF 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 24/86 (28%)
RRM2_TDP43 193..262 CDD:409761 11/48 (23%)
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:409789 22/80 (28%)
RRM3_TIA1_like 416..489 CDD:409790 11/47 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.