DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and maca

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_650473.1 Gene:maca / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster


Alignment Length:178 Identity:45/178 - (25%)
Similarity:81/178 - (45%) Gaps:26/178 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LENSTAKTKRTEAHLRCFDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVR 154
            |.|...||          :||:..|..:.||.:|...|..:|::.||:|.:..|:|.|..:||| 
  Fly    34 LPNLRMKT----------NLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFV- 87

  Fly   155 FGSYDVQMHVLSKRHSIDG---RWCEVKVPASRGMGNQE-PGKVFVGRCTEDIEADDLREYFSKF 215
              .|..:....:..:.:||   |...:||..:|....:. ...::||.....::...:||.|:.:
  Fly    88 --DYVSERQAAAAVNGMDGYETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATY 150

  Fly   216 GEVIDV-FIPKPF----RAFSFVTF---LDPYVPRVVCGEKHIIKGVS 255
            |.::|| .:...|    |..:|:.|   .|..|.:... ::::|:|.|
  Fly   151 GNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGM-DRYMIEGAS 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 22/75 (29%)
RRM2_TDP43 193..262 CDD:409761 17/71 (24%)
macaNP_650473.1 sex-lethal <41..>210 CDD:273740 42/171 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.