DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and sqd

DIOPT Version :9

Sequence 1:NP_001261874.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster


Alignment Length:194 Identity:58/194 - (29%)
Similarity:98/194 - (50%) Gaps:22/194 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SEDNLENSTAKTKRTEAHLRCFDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGF 150
            |.||  .|.|..:|.:..    .|.|.|||:.|||::||::|..||::....:|.|.::|.|:||
  Fly    41 SSDN--QSAASGQRDDDR----KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGF 99

  Fly   151 GFVRFGSYD-VQMHVLSKRHSIDGRWCEVKVPASRGMGNQEPGKVFVGRCTEDIEADDLREYFSK 214
            .|:.|.:.: :.....:..|.|:.:..:.|...:|      .||:|||..|.:|..::::.||.:
  Fly   100 AFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKAR------HGKIFVGGLTTEISDEEIKTYFGQ 158

  Fly   215 FGEVIDVFIP-----KPFRAFSFVTF-LDPYVPRVVCGEKHIIKGVSVHVSTADKKNVQNKNQL 272
            ||.:::|.:|     ...:.|.|:|| .:..|..::...|..|.|..|.|..|..|   .:||:
  Fly   159 FGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPK---PENQM 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_001261874.1 RRM1_TDP43 108..184 CDD:240767 24/76 (32%)
RRM2_TDP43 193..262 CDD:240768 22/74 (30%)
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 23/70 (33%)
RRM2_hnRNPD_like 137..211 CDD:240775 22/73 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.