DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and msi2b

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_957403.1 Gene:msi2b / 394084 ZFINID:ZDB-GENE-040426-1268 Length:408 Species:Danio rerio


Alignment Length:173 Identity:48/173 - (27%)
Similarity:81/173 - (46%) Gaps:24/173 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFG-SYDVQMHVLSKRHSID 172
            :.:.|||:.|:...||:||..:|::.:..:.:|..:..|:|||||.|. :..|...:....|.:|
Zfish    23 MFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLAQPHHELD 87

  Fly   173 GRWCEVKVPASRGMGNQEP------GKVFVGRCTEDIEADDLREYFSKFGEVIDVFI-----PKP 226
            .:..:.||...|   ..:|      .|:|||..:.:...:|:::||.:||:|.|..:     ...
Zfish    88 SKTIDPKVAFPR---RAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNR 149

  Fly   227 FRAFSFVTFLDPYVPRVVCGEKHIIKGVSVHVSTADKKNVQNK 269
            .|.|.||||.:..|...||         .:|....:.|.|:.|
Zfish   150 HRGFGFVTFENEDVVEKVC---------EIHFHEINNKMVECK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 21/72 (29%)
RRM2_TDP43 193..262 CDD:409761 21/73 (29%)
msi2bNP_957403.1 RRM1_MSI2 17..109 CDD:410153 24/88 (27%)
RRM2_MSI 111..184 CDD:240769 24/82 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.