DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and lark

DIOPT Version :9

Sequence 1:NP_001261874.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster


Alignment Length:166 Identity:46/166 - (27%)
Similarity:69/166 - (41%) Gaps:27/166 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 FDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYDVQMHVLSKRHSI 171
            |.|.:..|...|...:||..||.||.||:.::.|:        :|||...:.......:...:..
  Fly     7 FKLFIGNLDEKTQATELRALFEKYGTVVECDVVKN--------YGFVHMETEQQGRDAIQNLNGY 63

  Fly   172 DGRWCEVKVPA--SRGMGNQEPGKVFVGRCTEDIEADDLREYFSKFGEVIDVFIPKPFRAFSFVT 234
            ......:||.|  ||...|....|:|||..|:...|.::||.|.|:|.|::..|   .|.:.||.
  Fly    64 TLNEFAIKVEAAKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDI---VRNYGFVH 125

  Fly   235 F---------LDPYVPRVVCGEKHIIKGVSVHVSTA 261
            .         :.....|||.|:.     :.|.|||:
  Fly   126 LDCVGDVQDAIKELNGRVVDGQP-----LKVQVSTS 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_001261874.1 RRM1_TDP43 108..184 CDD:240767 18/77 (23%)
RRM2_TDP43 193..262 CDD:240768 24/78 (31%)
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 16/72 (22%)
RRM1_2_CoAA_like 87..152 CDD:409779 20/72 (28%)
hnRNP-R-Q <88..>258 CDD:273732 23/77 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439649
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.