DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and shep

DIOPT Version :9

Sequence 1:NP_001261874.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001246636.1 Gene:shep / 38605 FlyBaseID:FBgn0052423 Length:590 Species:Drosophila melanogaster


Alignment Length:210 Identity:42/210 - (20%)
Similarity:78/210 - (37%) Gaps:47/210 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 NKRQSEDNL-ENSTAKTKRTEA--HLRCFDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTR 143
            |...:..|: .|.|.:.:..:.  .|...:|.:.||...||::||......||.::..:...|..
  Fly   215 NTTNTNTNMGPNGTVQNQNQQGGEQLSKTNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKT 279

  Fly   144 SGHSKGFGFVRFGSYDVQMHVLSKRHSIDGRWCEVKVPASRGM-------GNQEPGKVFVGRCTE 201
            :...||:|||     |.:....::        |.||....:|:       ..|:|..:::.....
  Fly   280 TNKCKGYGFV-----DFEQPAFAE--------CAVKGLQGKGVQAQMAKQQEQDPTNLYIANLPP 331

  Fly   202 DIEADDLREYFSKFGEVIDVFIPKPFRAFSFVTFLDPYVPRVVCGEKHIIKGVSVHVSTADKKNV 266
            ..:..||....||:|:|:..                    |::..::...|||..    |..::.
  Fly   332 HFKETDLEAMLSKYGQVVST--------------------RILRDQQMNSKGVGF----ARMESR 372

  Fly   267 QNKNQLFQTNNYNNL 281
            :...|:.|..|.|.:
  Fly   373 EKCEQIIQMFNGNTI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_001261874.1 RRM1_TDP43 108..184 CDD:240767 19/75 (25%)
RRM2_TDP43 193..262 CDD:240768 10/68 (15%)
shepNP_001246636.1 RRM1_MSSP 243..313 CDD:240689 20/82 (24%)
RRM2_MSSP 322..400 CDD:240690 15/90 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439594
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.