DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and CG1316

DIOPT Version :9

Sequence 1:NP_001261874.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster


Alignment Length:194 Identity:50/194 - (25%)
Similarity:83/194 - (42%) Gaps:34/194 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 TEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFG----SYDVQMHVLSKRHSIDGRWCEVK 179
            ||:|.||.|..||::....:.||..:..:||..:|:|.    :...|..:..|......|..:|.
  Fly    39 TEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRTLKVL 103

  Fly   180 VPASRGMGNQEPG-------KVFV---GRCTEDIEADDLREYFSKFGEVIDVFIPK------PFR 228
            |.|:|..|:.:..       ::|:   ...||    :|:||.||::|:|..|.|.|      | :
  Fly   104 VA
ANRNQGSNKSENEQEKYVRLFIVIPKTATE----EDIREEFSQWGDVESVTIVKEKNNGNP-K 163

  Fly   229 AFSFVTFLDPYVPRVV---CGEKHIIKGVSVHVSTADKKNVQNK----NQLFQTNNYNNLDNNF 285
            .|.:|.|...|...|.   |..|:.........||..:::...:    |.|:.::...|  :||
  Fly   164 GFGYVRFTKFYYAAVAFENCSAKYKAVFAEPKGSTRTQRDQYGRPSEDNPLYSSSGRGN--SNF 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_001261874.1 RRM1_TDP43 108..184 CDD:240767 20/68 (29%)
RRM2_TDP43 193..262 CDD:240768 23/80 (29%)
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 18/65 (28%)
RRM2_RBM45 122..195 CDD:240813 21/77 (27%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439641
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.