DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and Hnrnpa2b1

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001098083.2 Gene:Hnrnpa2b1 / 362361 RGDID:1310403 Length:353 Species:Rattus norvegicus


Alignment Length:233 Identity:75/233 - (32%)
Similarity:111/233 - (47%) Gaps:31/233 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 EDNLENSTAKTKRTEAHLRCFDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFG 151
            |..||....:.|:.|.. :...|.:.|||:.|||:.||.|:|.:|.:....:.:|..|..|:|||
  Rat     2 EKTLETVPLERKKREKE-QFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFG 65

  Fly   152 FVRFGSY-DVQMHVLSKRHSIDGRWCEVKVPASRGMGNQEPG---------KVFVGRCTEDIEAD 206
            ||.|.|. :|...:.::.||||||..|.|    |.:..:|.|         |:|||...||.|..
  Rat    66 FVTFSSMAEVDAAMAARPHSIDGRVVEPK----RAVAREESGKPGAHVTVKKLFVGGIKEDTEEH 126

  Fly   207 DLREYFSKFGEV--IDVFIPKPF---RAFSFVTF--LDPYVPRVVCGEKHIIKGVSVHVSTADKK 264
            .||:||.::|::  |::...:..   |.|.||||  .|| |.::|..:.|.|.|.:..|..|..:
  Rat   127 HLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDP-VDKIVLQKYHTINGHNAEVRKALSR 190

  Fly   265 NVQNKNQLFQTNNYNNL--------DNNFKMQPANNFR 294
            ....:.|..::....|.        ..||...|.:|||
  Rat   191 QEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 31/73 (42%)
RRM2_TDP43 193..262 CDD:409761 27/75 (36%)
Hnrnpa2b1NP_001098083.2 Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:P22626, ECO:0000255 9..15 1/5 (20%)
RRM1_hnRNPA2B1 19..99 CDD:410155 32/83 (39%)
RRM2_hnRNPA2B1 112..191 CDD:409995 28/79 (35%)
Disordered. /evidence=ECO:0000269|PubMed:24098712 193..353 8/36 (22%)
HnRNPA1 302..326 CDD:463312
Nuclear targeting sequence. /evidence=ECO:0000250|UniProtKB:P22626 308..347
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.