DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and Hrb27C

DIOPT Version :9

Sequence 1:NP_001261874.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001162897.1 Gene:Hrb27C / 33968 FlyBaseID:FBgn0004838 Length:421 Species:Drosophila melanogaster


Alignment Length:230 Identity:72/230 - (31%)
Similarity:105/230 - (45%) Gaps:27/230 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYDVQMHVLSK-RHSID 172
            |.|.|||:.||:::|..||..:||::...:.|:..||.|:|||||.|.......|||.. .|::|
  Fly     9 LFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTLD 73

  Fly   173 GRWCEVKVPASRGMGNQEPG---KVFVGRCTEDIEADDLREYFSKFGEVIDVFI-----PKPFRA 229
            ||..:.|....|.:...:.|   |||:|....::...|||.:|:::|:|.:|.|     .|..|.
  Fly    74 GRTIDPKPCNPRTLQK
PKKGGGYKVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRG 138

  Fly   230 FSFVTFLDPYVPRVVCGEKHI-IKGVSVHVSTA---DKKNVQNKNQLFQTNNYNNLDNNFK---- 286
            |.|::|.:......|..|::| :.|..|.:..|   |....||.|.......|..|.|...    
  Fly   139 FGFLSFEEESSVEHVTNERYINLNGKQVEIKKAEPRDGSGGQNSNNSTVGGAYGKLGNECSHWGP 203

  Fly   287 -------MQPANNFRMHPANNFSMHSFN--PHGYQ 312
                   ||..|.....|..|..:.:.|  | |||
  Fly   204 HHAPINMMQGQNGQMGGPPLNMPIGAPNMMP-GYQ 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_001261874.1 RRM1_TDP43 108..184 CDD:240767 30/75 (40%)
RRM2_TDP43 193..262 CDD:240768 23/77 (30%)
Hrb27CNP_001162897.1 RRM1_DAZAP1 8..89 CDD:241018 31/79 (39%)
RRM2_DAZAP1 94..173 CDD:240773 23/78 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.