DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and hnrnpa0b

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_999871.1 Gene:hnrnpa0b / 334222 ZFINID:ZDB-GENE-030131-6154 Length:314 Species:Danio rerio


Alignment Length:176 Identity:58/176 - (32%)
Similarity:87/176 - (49%) Gaps:21/176 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFG-SYDVQMHVLSKRHSID 172
            |.|.||:..||...||.|||.:|::....:.::.:...|:.||||.:. |.:....:.::.|.:|
Zfish    10 LFVGGLNVQTTNDGLRSYFEQFGNLTDCVVVQNDQLQRSRCFGFVTYSTSEEADAAMAARPHVVD 74

  Fly   173 GRWCEVKVPASRGMGNQEPG---------KVFVGRCTEDIEADDLREYFSKFG--EVIDVFIPKP 226
            |:..|||    |.:..::.|         |:|||...:|||..||.|:||:||  |..:|...|.
Zfish    75 GKNVEVK----RAV
AREDAGRPEALAKVKKIFVGGLKDDIEEKDLTEFFSQFGMIEKSEVITDKD 135

  Fly   227 F---RAFSFVTFLD-PYVPRVVCGEKHIIKGVSVHVSTA-DKKNVQ 267
            .   |.|.||.|.| ....:.|..:.|:|.|..|.|..| .|:.:|
Zfish   136 TGKKRGFGFVHFEDNDSADKAVVLKFHMINGHKVEVKKALTKQEIQ 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 24/72 (33%)
RRM2_TDP43 193..262 CDD:409761 30/75 (40%)
hnrnpa0bNP_999871.1 RRM_SF 6..84 CDD:473069 25/77 (32%)
RRM_SF 100..179 CDD:473069 31/78 (40%)
HnRNPA1 263..294 CDD:463312
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.