DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and rbm14a

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001108616.1 Gene:rbm14a / 323721 ZFINID:ZDB-GENE-050522-496 Length:471 Species:Danio rerio


Alignment Length:132 Identity:37/132 - (28%)
Similarity:55/132 - (41%) Gaps:19/132 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRF---GSYDVQMHVLSKRHS 170
            |.|..|...||:.||...|..:|:||...:.:.        |.||..   |:.|..:..|:.| .
Zfish     9 LFVGNLDLETTQDDLIALFAPFGEVVHITVLRQ--------FAFVHLQGEGAADSAIRDLNGR-E 64

  Fly   171 IDGRWCEVKVPASRGMGNQEPGKVFVGRCTEDIEADDLREYFSKFGEVIDV----FIPKPFRAFS 231
            ..||...|:....|.:.:.   |||||........:||.:.||.:|:|:|.    ..|.....::
Zfish    65 YRGRSLVVEES
KGRPLNST---KVFVGNLCASCSVEDLYDLFSPYGKVLDCDKVKTKPSSLTGYA 126

  Fly   232 FV 233
            ||
Zfish   127 FV 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 21/74 (28%)
RRM2_TDP43 193..262 CDD:409761 15/45 (33%)
rbm14aNP_001108616.1 RRM_SF 7..75 CDD:473069 21/74 (28%)
RRM_SF 84..156 CDD:473069 15/45 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.