Sequence 1: | NP_001261874.1 | Gene: | cocoon / 39665 | FlyBaseID: | FBgn0036496 | Length: | 318 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001096965.1 | Gene: | fne / 32245 | FlyBaseID: | FBgn0086675 | Length: | 356 | Species: | Drosophila melanogaster |
Alignment Length: | 276 | Identity: | 57/276 - (20%) |
---|---|---|---|
Similarity: | 90/276 - (32%) | Gaps: | 100/276 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 KAVRGVRSNEGRLYSPSEET------------GWGEYHYFCVFPKKNKRQSED-----------N 89
Fly 90 LENSTAK---TKRTEAHLRCFDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFG 151
Fly 152 FVRFG------------------SYDVQMHVLSKRHSIDGRWCEVKVP-----------ASRGM- 186
Fly 187 -------------------------GNQEPGK---VFVGRCTEDIEADDLREYFSKFGEVIDVFI 223
Fly 224 PKPF-----RAFSFVT 234 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cocoon | NP_001261874.1 | RRM1_TDP43 | 108..184 | CDD:240767 | 24/104 (23%) |
RRM2_TDP43 | 193..262 | CDD:240768 | 13/50 (26%) | ||
fne | NP_001096965.1 | ELAV_HUD_SF | 23..354 | CDD:273741 | 57/276 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45439644 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |