DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and fne

DIOPT Version :9

Sequence 1:NP_001261874.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster


Alignment Length:276 Identity:57/276 - (20%)
Similarity:90/276 - (32%) Gaps:100/276 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KAVRGVRSNEGRLYSPSEET------------GWGEYHYFCVFPKKNKRQSED-----------N 89
            |.||...|  |.|..|:..|            |:|..:|.         ::||           .
  Fly    56 KLVRDKVS--GNLVLPASLTALNPALQQGQSLGYGFVNYV---------RAEDAEKAVNTLNGLR 109

  Fly    90 LENSTAK---TKRTEAHLRCFDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFG 151
            |:|...|   .:.:...::..:|.|.||..|.::.||...|.::|.::.:.|..|..||.|||.|
  Fly   110 LQNKVIKVSYARPSSESIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVG 174

  Fly   152 FVRFG------------------SYDVQMHVLSKRHSIDGRWCEVKVP-----------ASRGM- 186
            |:||.                  .|...:.|....:..:....::..|           |:|.: 
  Fly   175 FIRFDQRNEAERAIQELNGKTPKGYAEPITVKFANNPSNSAKAQIAPPLTAYLTPQAAAATRRLA 239

  Fly   187 -------------------------GNQEPGK---VFVGRCTEDIEADDLREYFSKFGEVIDVFI 223
                                     ||...|.   :||.....:.|.:.|.:.|..||.|..|.:
  Fly   240 GALPSAGRIRYSPLAGDLLANSILPGNAMTGSGWCIFVYNLAPETEENVLWQLFGPFGAVQSVKV 304

  Fly   224 PKPF-----RAFSFVT 234
            .:..     :.|.|||
  Fly   305 IRDLQTSKCKGFGFVT 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_001261874.1 RRM1_TDP43 108..184 CDD:240767 24/104 (23%)
RRM2_TDP43 193..262 CDD:240768 13/50 (26%)
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 57/276 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439644
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.