DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and Spx

DIOPT Version :9

Sequence 1:NP_001261874.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster


Alignment Length:222 Identity:55/222 - (24%)
Similarity:86/222 - (38%) Gaps:57/222 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRF-----GSYDVQMHVLSKRHSID 172
            ||....:|..|.|.|...|.||...:.||..:...:|:|||.|     ..|.:::..:.|.:   
  Fly    19 GLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGIKIMNMIKLY--- 80

  Fly   173 GRWCEVKVPASRGMGNQEPG-KVFVGRCTEDIEADD--LREYFSKFGEVIDVFIPKPFR------ 228
            |:...|. .||....|.:.| .:|:|..  |:|.|:  |.:.||.||.::..  ||..|      
  Fly    81 GKPIRVN-K
ASAHQKNLDVGANIFIGNL--DVEVDEKLLYDTFSAFGVILQT--PKIMRDPETGK 140

  Fly   229 --AFSFVTF---------LDPYVPRVVCGEKHIIKGVSVHVSTADKKNVQNKNQLFQTNNYNNLD 282
              :|:|:.|         :|....:.:|..       .:.||.|.||                 |
  Fly   141 SKSFAFINFASFEASDAAMDAMNGQYLCNR-------PISVSYAFKK-----------------D 181

  Fly   283 NNFKMQPANNFRMHPANNFSMHSFNPH 309
            :..:...:...|:..|.|.|.|:..||
  Fly   182 HKGERHGSAAERLLAAQNPSTHADRPH 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_001261874.1 RRM1_TDP43 108..184 CDD:240767 21/75 (28%)
RRM2_TDP43 193..262 CDD:240768 20/87 (23%)
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 20/72 (28%)
RRM2_SF3B4 99..181 CDD:240781 24/109 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439631
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.