DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and eIF3g1

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster


Alignment Length:45 Identity:16/45 - (35%)
Similarity:23/45 - (51%) Gaps:0/45 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 VLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRF 155
            :..||.:.||.||.|..:..|...|..:.:|..:|..|||.:|.|
  Fly   192 ISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHF 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 16/45 (36%)
RRM2_TDP43 193..262 CDD:409761
eIF3g1NP_570011.1 eIF3g 23..140 CDD:463545
RRM_eIF3G_like 190..264 CDD:409842 16/45 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.