DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and tif307

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_595727.1 Gene:tif307 / 2540819 PomBaseID:SPBC18H10.03 Length:282 Species:Schizosaccharomyces pombe


Alignment Length:137 Identity:38/137 - (27%)
Similarity:57/137 - (41%) Gaps:31/137 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GVRSNEGRLYSPSEETGWGEYHYFCVFPKKNKRQSEDNLENSTAKTKRTEAHLRCFDLIVLGLSY 116
            |....:||..:|....|.|......:|    ||:.:|:            |.||     |..||.
pombe   168 GALGEKGRYIAPHLRAGSGRESGDSMF----KRERDDS------------ATLR-----VTNLSD 211

  Fly   117 NTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYDVQMHVLSKRHSIDG-RW----- 175
            :|.|::||:.|..:|.:.:..:.||..:|.:|||.||.:...|.   .:..|..:|| .|     
pombe   212 DTREEELRDLFRRFGGIQRVYLAKDKETGRAKGFAFVSYYDRDC---AIKARDRLDGYGWNNLIL 273

  Fly   176 -CEVKVP 181
             ||...|
pombe   274 RCEFSKP 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833 6/25 (24%)
RRM1_TDP43 108..181 CDD:409760 24/79 (30%)
RRM2_TDP43 193..262 CDD:409761
tif307NP_595727.1 eIF3g 21..148 CDD:463545
RRM_eIF3G_like 203..278 CDD:409842 26/82 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.