DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and sqd-1

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001380080.1 Gene:sqd-1 / 177392 WormBaseID:WBGene00022235 Length:308 Species:Caenorhabditis elegans


Alignment Length:202 Identity:64/202 - (31%)
Similarity:93/202 - (46%) Gaps:37/202 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KKNKRQSEDNLENSTAKTKRTEAHLRCFDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRS 144
            |.|...||...||..: ||..|..    .:.|.|:|.....:||..:|..||:|.:|::|.|..:
 Worm     7 KINGNASETIKENGHS-TKGNEDK----KIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTN 66

  Fly   145 GHSKGFGFVRFGSYD-VQMHVLSKRHSIDGRWCEVKVPASRGMGNQEPGKVFVGRCTEDIEADDL 208
            |.|:||.||.|.:.: .::.:.::..:|.|:..|||...||     |..|||||....|....||
 Worm    67 GRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAKSR-----ENKKVFVGGLPSDYSEQDL 126

  Fly   209 REYFSKFGEVIDVFIP-----KPFRAFSFVTFLDPYVPRVVCGEKHIIKGVSVHVSTADKKNVQN 268
            |.:|.:||:|.|:..|     |..|.|:|:.|.:.                    .:|||.:.|.
 Worm   127 RSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEE--------------------ESADKASSQT 171

  Fly   269 KNQLFQT 275
            | |.|.|
 Worm   172 K-QTFGT 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 24/73 (33%)
RRM2_TDP43 193..262 CDD:409761 20/73 (27%)
sqd-1NP_001380080.1 RRM2_NsCP33_like 30..104 CDD:410187 24/73 (33%)
RRM_SF 111..185 CDD:473069 28/88 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.