DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and Msi1

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_032655.1 Gene:Msi1 / 17690 MGIID:107376 Length:362 Species:Mus musculus


Alignment Length:173 Identity:53/173 - (30%)
Similarity:81/173 - (46%) Gaps:16/173 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRF-GSYDVQMHVLSKRHSID 172
            :.:.|||:.||::.|||||..:|:|.:..:.:|..:..|:|||||.| ....|...:...||.:|
Mouse    22 MFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELD 86

  Fly   173 GRWCEVKVPASRGMGNQEP------GKVFVGRCTEDIEADDLREYFSKFGEVIDVFI-----PKP 226
            .:..:.||...|   ..:|      .|:|||..:.:...:|::.||.:||:|.|..:     ...
Mouse    87 SKTIDPKVAFPR---RAQPKMVTRTKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNR 148

  Fly   227 FRAFSFVTFLDPYVPRVVCG-EKHIIKGVSVHVSTADKKNVQN 268
            .|.|.||||....:...||. ..|.|....|....|..|.|.:
Mouse   149 HRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMS 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 25/72 (35%)
RRM2_TDP43 193..262 CDD:409761 22/74 (30%)
Msi1NP_032655.1 RRM1_MSI 21..96 CDD:409990 26/73 (36%)
PABP-1234 <32..312 CDD:130689 49/163 (30%)
RRM2_MSI 110..183 CDD:240769 22/72 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.