DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and tdp-1

DIOPT Version :9

Sequence 1:NP_001261874.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001254189.1 Gene:tdp-1 / 174436 WormBaseID:WBGene00006514 Length:414 Species:Caenorhabditis elegans


Alignment Length:306 Identity:108/306 - (35%)
Similarity:162/306 - (52%) Gaps:42/306 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FVHVSEKEGDEPIELPAEEDGTLLLSTLQAQFPESSGLQYRNVDTKAVRGVRSNEG--RLYSPSE 65
            |:.|.:..||||||||. .||.:|::||||.||.::||:|:|..|.|.|.|:.:..  :|.:|::
 Worm    47 FITVQDPNGDEPIELPT-VDGVVLMTTLQASFPGATGLKYKNPKTGANRAVQVDPSGLKLIAPAD 110

  Fly    66 ETGWGEYHYFCVFPKKNKR-----------------------QSEDNLENSTAKTKRTEAHLRCF 107
              ||....:|.:...:::|                       .|:|..:..:.:.:..|...:..
 Worm   111 --GWENKTFFVIVAPQSERVRALSSADATSAKRRKVGSSDDSDSDDGRDGRSGRKRAVERDSQPV 173

  Fly   108 DLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYDVQMHVLS-KRHSI 171
            ||||||:.:.||::..::|||..|.||..|||:.: .|:||||||||..|...|..||: .:|.|
 Worm   174 DLIVLGVDFKTTDECFQKYFEDIGTVVFCEIKRKS-DGNSKGFGFVRMSSVGEQNKVLAIPQHMI 237

  Fly   172 DGRWCEVKVPASRGM----GNQEPGKVFVGRCTEDIEADDLREYFS-------KFGEVIDVFIPK 225
            |||.|:||||..|.:    |.....::||||.|:.::...||:.|.       :...|.||||||
 Worm   238 DGRRCDVKVPDGRSLQDKQGRPSISRIFVGRLTDKVDEHQLRKVFGDEAKSYIETAVVTDVFIPK 302

  Fly   226 PFRAFSFVTFLD-PYVPRVVCGEKHIIKGVSVHVSTADKKNVQNKN 270
            |||.|:|||... ....|:|......:.|:||.:|.|..:...|::
 Worm   303 PFRGFAFVTLSSAEAAERIVSKGSLTVNGLSVGLSIAQPREENNQS 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_001261874.1 RRM1_TDP43 108..184 CDD:240767 40/76 (53%)
RRM2_TDP43 193..262 CDD:240768 28/76 (37%)
tdp-1NP_001254189.1 RRM_SF 174..247 CDD:302621 38/73 (52%)
RRM_SF 262..339 CDD:302621 28/76 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167671
Domainoid 1 1.000 64 1.000 Domainoid score I6685
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134087
Inparanoid 1 1.050 183 1.000 Inparanoid score I2627
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48344
OrthoDB 1 1.010 - - D390211at33208
OrthoFinder 1 1.000 - - FOG0005498
OrthoInspector 1 1.000 - - otm14766
orthoMCL 1 0.900 - - OOG6_105367
Panther 1 1.100 - - O PTHR48033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3916
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.