DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and eif-3.G

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001263666.1 Gene:eif-3.G / 174346 WormBaseID:WBGene00001230 Length:262 Species:Caenorhabditis elegans


Alignment Length:61 Identity:20/61 - (32%)
Similarity:30/61 - (49%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 VLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYDVQMHVLSKRHSI 171
            |..|.....|.:||:.|...|.|::..|.:|..:|..|||.||.|.|.|.....:::.:.|
 Worm   186 VTNLPQEMNEDELRDLFGKIGRVIRIFIARDKVTGLPKGFAFVTFESRDDAARAIAELNDI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 20/61 (33%)
RRM2_TDP43 193..262 CDD:409761
eif-3.GNP_001263666.1 eIF3G 33..143 CDD:240597
RRM_eIF3G_like 183..257 CDD:409842 20/61 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.