DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and Hnrnpa1

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001034218.1 Gene:Hnrnpa1 / 15382 MGIID:104820 Length:373 Species:Mus musculus


Alignment Length:185 Identity:62/185 - (33%)
Similarity:98/185 - (52%) Gaps:16/185 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 STAKTKRTEAHLRCFDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGS 157
            |.:::.:....||  .|.:.|||:.||::.||.:||.:|.:....:.:|..:..|:|||||.:.:
Mouse     2 SKSESPKEPEQLR--KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYAT 64

  Fly   158 Y-DVQMHVLSKRHSIDGRWCEVKVPASRGMGNQEPG------KVFVGRCTEDIEADDLREYFSKF 215
            . :|...:.::.|.:|||..|.|...|| ..:|.||      |:|||...||.|...||:||.::
Mouse    65 VEEVDAAMNARPHKVDGRVVEPKRAVSR-EDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQY 128

  Fly   216 G--EVIDVFIPK---PFRAFSFVTFLD-PYVPRVVCGEKHIIKGVSVHVSTADKK 264
            |  |||::...:   ..|.|:||||.| ..|.::|..:.|.:.|.:..|..|..|
Mouse   129 GKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 25/73 (34%)
RRM2_TDP43 193..262 CDD:409761 27/74 (36%)
Hnrnpa1NP_001034218.1 RRM1_hnRNPA1 12..92 CDD:410154 27/81 (33%)
RRM2_hnRNPA3 105..184 CDD:409996 29/79 (37%)
HnRNPA1 313..345 CDD:463312
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.