DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and Caper

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:XP_317010.4 Gene:Caper / 1277542 VectorBaseID:AGAMI1_007869 Length:595 Species:Anopheles gambiae


Alignment Length:127 Identity:34/127 - (26%)
Similarity:52/127 - (40%) Gaps:27/127 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KKNKRQSEDNLENSTAKTKRTEAHLRCFDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRS 144
            :||:..|:.    ..|..|.....:|   |.|..|.:|.||..|...||.:|.:...::..|..:
Mosquito   318 EKNRMASQP----PVAPPKNPSGPMR---LYVGSLHFNITEDMLNGIFEPFGKIDNIQLIMDADT 375

  Fly   145 GHSKGFGFVRFGSYDVQMHVLSKRHSID--GRWCEVKVPASRGMGNQEPGKVFVGRCTEDIE 204
            |.|||:||:.|.:.|.....|.:.:..:  ||                |.|  ||..||.::
Mosquito   376 GRSKGYGFITFHNADDAKKALEQLNGFELAGR----------------PMK--VGNVTERLD 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 22/74 (30%)
RRM2_TDP43 193..262 CDD:409761 5/12 (42%)
CaperXP_317010.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.