DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-6 and lrrc15

DIOPT Version :9

Sequence 1:NP_001246765.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_001074151.1 Gene:lrrc15 / 791200 ZFINID:ZDB-GENE-031113-8 Length:564 Species:Danio rerio


Alignment Length:581 Identity:143/581 - (24%)
Similarity:238/581 - (40%) Gaps:152/581 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 SLPDNIFCTLSELSALNMSENRLQDVNELGFRDRSKEPT-NGSTESTSTTESAKKSSSSSTSCSL 277
            |.|::..|.::::.....|      |.|:..   ...|| |....|.::.:|.|.|...:.:.:|
Zfish    20 SCPESCQCQVTKIVCQGFS------VKEIPL---PMPPTINALVISNTSIQSLKPSDFQTFAETL 75

  Fly   278 DLEYLDVSHNDFVVLPANGFGTLRRLRVLSVNNNGISMIADKALSGLKNLQILNLSSNKIVALPT 342
            .| ::..:.|...|.| :.|.....|..|..:...::.:.|.....|..|..|.||.||:..||:
Zfish    76 TL-FVAKNSNITEVEP-HTFDQAFNLNALGFSGTMLTSLPDNLFQNLTALTTLTLSGNKLEVLPS 138

  Fly   343 ELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFVGLIRLVLLNL 407
            .|....|. :.::.|..|.:|.|:...|..||||:.|.|..|.|..  :..:||.||..|..|.|
Zfish   139 SLLTPLAN-VNKLDLSKNLLSSLSEDAFRGLDQLEMLMLQRNSIKQ--LHSSTFQGLSHLRSLFL 200

  Fly   408 SHNKLTKLEPEIFSDLYTLQILNLRHNQLENIAADTFAPMNNLHTLLLSHNKLKYLDAYALNGLY 472
            ..|:||.:...:|.||..|::|:|:.|::|.:.|:.||.:.||..|.||.|:|..|.:.....|.
Zfish   201 QQNQLTDIPAGLFDDLVNLEVLHLQDNKIEQLPANLFAKVQNLKKLYLSSNRLSLLPSGIFLSLP 265

  Fly   473 VLSLLSLDNNALIGVHPDAFRNCSALQDLNLNGNQLKTVPLALRNMRHLRTVDLGENMITVMEDS 537
            .|:.:||.:|.|..:.|:.| ...|||:|.|.                       :|::|.:|  
Zfish   266 NLTHISLYDNRLSRLMPETF-GTMALQELWLY-----------------------DNLLTHLE-- 304

  Fly   538 AFKGLGNLYGLRLIGNYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFEMTSSIQAVRLDGNE 602
                              ||:    |.:|.|:::|.::||||..:.||||.....::.|.|..|.
Zfish   305 ------------------ENV----FSNLTNIRLLVISRNRIQYISPGAFNGLKELKEVSLHTNR 347

  Fly   603 LNDIN-GLFSNMPSLLWLNISDNRLESFDYGHVPSTLQWLDLHKNRLSSLSNRFGLDSELKLQTL 666
            |.:|. |:|..:|:|..::|.:|:::     .:|..|                  ||...:|..|
Zfish   348 LTNIEPGIFRGLPNLANISIENNQIK-----QIPIQL------------------LDGVSRLSLL 389

  Fly   667 DVSFNQLQRIGPSSIPNSIELLFLNDNLITTVDPDTFMHKTNLTRVDLYANQITTLDIKSLRILP 731
            ::..|.||.: |....|::.::   :|:|        :|:                         
Zfish   390 EMQNNSLQNL-PKDFLNTLSIV---ENVI--------LHE------------------------- 417

  Fly   732 VWEHRALPEFYIGGNPFTCDCNI----DWLQKINHITSRQYPRIMDLETIYCKL---LNNR 785
                          ||:.||.:|    .||       |:...::.:|..:.|..   ||.|
Zfish   418 --------------NPWRCDQDIIPFWGWL-------SQHSEKVKNLSLVMCSSPPPLNGR 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-6NP_001246765.1 leucine-rich repeat 148..171 CDD:275380
LRR_8 171..236 CDD:290566 4/21 (19%)
leucine-rich repeat 172..201 CDD:275380
leucine-rich repeat 202..278 CDD:275380 13/64 (20%)
leucine-rich repeat 229..249 CDD:275380 3/19 (16%)
LRR_RI 278..468 CDD:238064 61/189 (32%)
leucine-rich repeat 279..302 CDD:275380 5/22 (23%)
LRR_8 301..386 CDD:290566 26/84 (31%)
leucine-rich repeat 303..326 CDD:275380 4/22 (18%)
leucine-rich repeat 327..350 CDD:275380 9/22 (41%)
LRR 350..729 CDD:227223 97/379 (26%)
leucine-rich repeat 352..375 CDD:275380 6/22 (27%)
leucine-rich repeat 376..401 CDD:275380 9/24 (38%)
LRR_RI <401..626 CDD:238064 66/225 (29%)
leucine-rich repeat 402..425 CDD:275380 9/22 (41%)
leucine-rich repeat 426..449 CDD:275380 8/22 (36%)
leucine-rich repeat 450..473 CDD:275380 8/22 (36%)
leucine-rich repeat 474..497 CDD:275380 7/22 (32%)
leucine-rich repeat 498..518 CDD:275380 4/19 (21%)
leucine-rich repeat 521..544 CDD:275380 3/22 (14%)
leucine-rich repeat 545..566 CDD:275380 3/20 (15%)
leucine-rich repeat 569..592 CDD:275380 9/22 (41%)
leucine-rich repeat 593..615 CDD:275380 7/22 (32%)
leucine-rich repeat 616..637 CDD:275380 4/20 (20%)
leucine-rich repeat 638..662 CDD:275380 3/23 (13%)
leucine-rich repeat 663..684 CDD:275380 6/20 (30%)
leucine-rich repeat 685..708 CDD:275380 3/22 (14%)
leucine-rich repeat 709..728 CDD:275380 0/18 (0%)
LRR_8 883..943 CDD:290566
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
LRR_8 932..990 CDD:290566
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587
lrrc15NP_001074151.1 LRRNT 21..48 CDD:214470 5/35 (14%)
leucine-rich repeat 53..73 CDD:275380 4/19 (21%)
LRR_RI <163..253 CDD:238064 36/91 (40%)
LRR_8 170..229 CDD:290566 23/60 (38%)
leucine-rich repeat 171..194 CDD:275380 9/24 (38%)
leucine-rich repeat 195..218 CDD:275380 9/22 (41%)
LRR_8 218..277 CDD:290566 21/58 (36%)
leucine-rich repeat 219..242 CDD:275380 8/22 (36%)
LRR_4 241..280 CDD:289563 14/38 (37%)
leucine-rich repeat 243..266 CDD:275380 8/22 (36%)
leucine-rich repeat 267..289 CDD:275380 7/22 (32%)
leucine-rich repeat 290..313 CDD:275380 11/69 (16%)
LRR_8 312..372 CDD:290566 21/59 (36%)
leucine-rich repeat 314..337 CDD:275380 9/22 (41%)
leucine-rich repeat 338..361 CDD:275380 7/22 (32%)
leucine-rich repeat 362..385 CDD:275380 7/45 (16%)
TPKR_C2 418..467 CDD:301599 13/47 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45836
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.