DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-6 and LRTM2

DIOPT Version :9

Sequence 1:NP_001246765.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster
Sequence 2:XP_016875337.1 Gene:LRTM2 / 654429 HGNCID:32443 Length:427 Species:Homo sapiens


Alignment Length:246 Identity:68/246 - (27%)
Similarity:106/246 - (43%) Gaps:47/246 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 SCSLDLEYLDV--SHNDFVVLPANGFGTLRRLRVLSVNNNGISMIADKALSGLKNLQILNLSSNK 336
            ||..|...|:|  |......:|.:.....|.|.:|   ||.:|.:...|.:.|.:||.|:||:|.
Human    99 SCKCDSRSLEVDCSGLGLTTVPPDVPAATRTLLLL---NNKLSALPSWAFANLSSLQRLDLSNNF 160

  Fly   337 IVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFVGLIR 401
            :..||..:|.:... :.|:.|:||||..|:..|..:...|:.||||:                  
Human   161 LDRLPRSIFGDLTN-LTELQLRNNSIRTLDRDLLRHSPLLRHLDLSI------------------ 206

  Fly   402 LVLLNLSHNKLTKLEPEIFSDLYTLQILNLRHNQLENIAADTFAPMNNLHTLLLSHNKLK----- 461
                    |.|.:|.|.:|..|..|:.|:||.|:|:|:...||.|:.||..|.:..|..:     
Human   207 --------NGLAQLPPGLFDGLLALRSLSLRSNRLQNLDRLTFEPLANLQLLQVGDNPWECDCNL 263

  Fly   462 -----YLDAYALNGLYVLSLLSLDNNALIG-----VHPDAFRNCSALQDLN 502
                 :::.::..|..:..|.......|.|     |..:.|..||.|:|.|
Human   264 REFKHWMEWFSYRGGRLDQLACTLPKELRGKDMRMVPMEMFNYCSQLEDEN 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-6NP_001246765.1 leucine-rich repeat 148..171 CDD:275380
LRR_8 171..236 CDD:290566
leucine-rich repeat 172..201 CDD:275380
leucine-rich repeat 202..278 CDD:275380 2/3 (67%)
leucine-rich repeat 229..249 CDD:275380
LRR_RI 278..468 CDD:238064 55/201 (27%)
leucine-rich repeat 279..302 CDD:275380 4/24 (17%)
LRR_8 301..386 CDD:290566 30/84 (36%)
leucine-rich repeat 303..326 CDD:275380 7/22 (32%)
leucine-rich repeat 327..350 CDD:275380 9/22 (41%)
LRR 350..729 CDD:227223 44/168 (26%)
leucine-rich repeat 352..375 CDD:275380 8/22 (36%)
leucine-rich repeat 376..401 CDD:275380 5/24 (21%)
LRR_RI <401..626 CDD:238064 31/117 (26%)
leucine-rich repeat 402..425 CDD:275380 6/22 (27%)
leucine-rich repeat 426..449 CDD:275380 10/22 (45%)
leucine-rich repeat 450..473 CDD:275380 4/32 (13%)
leucine-rich repeat 474..497 CDD:275380 6/27 (22%)
leucine-rich repeat 498..518 CDD:275380 3/5 (60%)
leucine-rich repeat 521..544 CDD:275380
leucine-rich repeat 545..566 CDD:275380
leucine-rich repeat 569..592 CDD:275380
leucine-rich repeat 593..615 CDD:275380
leucine-rich repeat 616..637 CDD:275380
leucine-rich repeat 638..662 CDD:275380
leucine-rich repeat 663..684 CDD:275380
leucine-rich repeat 685..708 CDD:275380
leucine-rich repeat 709..728 CDD:275380
LRR_8 883..943 CDD:290566
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
LRR_8 932..990 CDD:290566
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587
LRTM2XP_016875337.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45836
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.