DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-6 and LOC563710

DIOPT Version :9

Sequence 1:NP_001246765.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster
Sequence 2:XP_692159.4 Gene:LOC563710 / 563710 -ID:- Length:635 Species:Danio rerio


Alignment Length:396 Identity:100/396 - (25%)
Similarity:178/396 - (44%) Gaps:57/396 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 FRDRSKEPTNGSTESTSTTESAKKSSSSSTSCSLD-LEYLDVSHNDFVVLPANGFGTLRRLRVLS 307
            |||..|. .:|..:..|...::..|..:.....|: |.:|.:.||....:.|..|..:|||:.|.
Zfish    49 FRDVPKN-LSGGCQGLSLRYNSLASLKAGQFVGLNQLIWLYLDHNYIANVDARAFQGIRRLKELI 112

  Fly   308 VNNNGISMIADKALSGLKNLQILNLSSNKIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSN 372
            :::|.|:::.:.....:.||:.|:||.||:.||....|....|:: .:::::||:..|..:||.:
Zfish   113 LSSNKITLLHNTTFHLVPNLRNLDLSYNKLQALQPGQFQGLRKLL-SLHMRSNSLKNLPSRLFQD 176

  Fly   373 LDQLQALDLSMNQITSTWIDKNTFVGLIRLVLLNLSHNKLTKLEPEIFSDLYTLQILNLRHNQLE 437
            ...|:.|||..|::.|  |.:|:..||::|..|::.||:.:|:....|...|.|:.|.|:.|::.
Zfish   177 CRNLEFLDLGYNRLRS--ITRNSMSGLLKLTELHIEHNQFSKINFFNFPRFYNLRALYLQWNRIR 239

  Fly   438 NIAADTFAPMNNLHTLLLSHNKLKYLDAYALNGLYVLSLLSLDNNALIGVHPDAFRNCSALQDLN 502
            .::........:|..|.||.|.|:.:||.....:..|..|:||:|.|:.|..:|....::|..::
Zfish   240 TMSEGLTWMWTSLQKLDLSGNDLQEIDAEVYRAMPNLQTLNLDSNKLVNVSQEAVDAWTSLTAIS 304

  Fly   503 LNGNQLKTVPLALRNMRHLRTVDLGENMITVMEDSAFKGLGNLYGLRLIGNYLENITMHTFRDLP 567
            |.||.....|:....:..:||               |:           ||...|:...:.:::.
Zfish   305 LAGNMWDCGPVVCPLVAWMRT---------------FR-----------GNKEINMICASPKEVQ 343

  Fly   568 NLQILNLARN----RIAVVEPG----------AFEMTSSIQAV---------RLDGNELNDINGL 609
            ..::|:....    |||...|.          ||..|.:...|         |:.|..|   .|.
Zfish   344 GEKVLDAVDANGVCRIAPATPSTIFVPSTPFVAFSQTPASSLVPTLKSGDSRRVHGTSL---EGS 405

  Fly   610 FSNMPS 615
            .|::||
Zfish   406 TSSVPS 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-6NP_001246765.1 leucine-rich repeat 148..171 CDD:275380
LRR_8 171..236 CDD:290566
leucine-rich repeat 172..201 CDD:275380
leucine-rich repeat 202..278 CDD:275380 7/33 (21%)
leucine-rich repeat 229..249 CDD:275380 3/4 (75%)
LRR_RI 278..468 CDD:238064 57/190 (30%)
leucine-rich repeat 279..302 CDD:275380 6/22 (27%)
LRR_8 301..386 CDD:290566 27/84 (32%)
leucine-rich repeat 303..326 CDD:275380 4/22 (18%)
leucine-rich repeat 327..350 CDD:275380 9/22 (41%)
LRR 350..729 CDD:227223 70/289 (24%)
leucine-rich repeat 352..375 CDD:275380 5/22 (23%)
leucine-rich repeat 376..401 CDD:275380 10/24 (42%)
LRR_RI <401..626 CDD:238064 54/238 (23%)
leucine-rich repeat 402..425 CDD:275380 6/22 (27%)
leucine-rich repeat 426..449 CDD:275380 4/22 (18%)
leucine-rich repeat 450..473 CDD:275380 8/22 (36%)
leucine-rich repeat 474..497 CDD:275380 8/22 (36%)
leucine-rich repeat 498..518 CDD:275380 5/19 (26%)
leucine-rich repeat 521..544 CDD:275380 3/22 (14%)
leucine-rich repeat 545..566 CDD:275380 3/20 (15%)
leucine-rich repeat 569..592 CDD:275380 8/36 (22%)
leucine-rich repeat 593..615 CDD:275380 6/30 (20%)
leucine-rich repeat 616..637 CDD:275380 100/396 (25%)
leucine-rich repeat 638..662 CDD:275380
leucine-rich repeat 663..684 CDD:275380
leucine-rich repeat 685..708 CDD:275380
leucine-rich repeat 709..728 CDD:275380
LRR_8 883..943 CDD:290566
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
LRR_8 932..990 CDD:290566
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587
LOC563710XP_692159.4 leucine-rich repeat 60..83 CDD:275380 3/22 (14%)
LRR_RI <81..286 CDD:238064 63/207 (30%)
LRR_8 83..142 CDD:290566 18/58 (31%)
leucine-rich repeat 84..107 CDD:275380 6/22 (27%)
leucine-rich repeat 108..131 CDD:275380 4/22 (18%)
LRR_8 130..190 CDD:290566 21/60 (35%)
leucine-rich repeat 132..155 CDD:275380 9/22 (41%)
leucine-rich repeat 156..179 CDD:275380 5/23 (22%)
LRR_8 178..238 CDD:290566 21/61 (34%)
leucine-rich repeat 180..203 CDD:275380 10/24 (42%)
leucine-rich repeat 204..227 CDD:275380 6/22 (27%)
leucine-rich repeat 228..251 CDD:275380 4/22 (18%)
LRR_8 250..308 CDD:290566 18/57 (32%)
leucine-rich repeat 252..275 CDD:275380 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.