DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-6 and lrtm2a

DIOPT Version :9

Sequence 1:NP_001246765.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster
Sequence 2:XP_001923104.1 Gene:lrtm2a / 557289 ZFINID:ZDB-GENE-041210-218 Length:371 Species:Danio rerio


Alignment Length:209 Identity:65/209 - (31%)
Similarity:100/209 - (47%) Gaps:30/209 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 LSVNNNGISMIADKALSGLKNLQILNLSSNKIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLF 370
            |.:.||.:|.:...|.:.|..|:.|:||:|.:..||:.||.|.:. :.|:.|:|||::||:.:||
Zfish    73 LLLANNRLSSLPLSAFANLSTLETLDLSNNYLDNLPSRLFRELSN-LSELSLRNNSLTVLDRELF 136

  Fly   371 SNLDQLQALDLSMNQITSTWIDKNTFVGLI----RLVLLNLSHNKLTKLEPEIFSDLYTLQILNL 431
            ..|..|:.||||:|.:.:..:      ||:    :|..|:|:.|:|..||...|..|..||.|.|
Zfish   137 RGLTHLRKLDLSLNGLAAVPL------GLLDELQQLTWLSLAGNRLHALERATFEPLVNLQHLEL 195

  Fly   432 RHNQLENIAADTFAPMNNLHTLLLSHNKLKYLDAYALNGLYVLSL-----LSLDNNALIGVHPDA 491
            ..|..|   .|.     ||..  ..|    :::.....|.||.::     ..|....:.||..:.
Zfish   196 GMNPWE---CDC-----NLRD--FKH----WMEWLIYRGGYVDAVECTLPKDLRGRDIRGVPVEM 246

  Fly   492 FRNCSALQDLNLNG 505
            |..|..|:|.|..|
Zfish   247 FNYCLQLEDENGGG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-6NP_001246765.1 leucine-rich repeat 148..171 CDD:275380
LRR_8 171..236 CDD:290566
leucine-rich repeat 172..201 CDD:275380
leucine-rich repeat 202..278 CDD:275380
leucine-rich repeat 229..249 CDD:275380
LRR_RI 278..468 CDD:238064 53/165 (32%)
leucine-rich repeat 279..302 CDD:275380
LRR_8 301..386 CDD:290566 32/79 (41%)
leucine-rich repeat 303..326 CDD:275380 6/19 (32%)
leucine-rich repeat 327..350 CDD:275380 10/22 (45%)
LRR 350..729 CDD:227223 49/165 (30%)
leucine-rich repeat 352..375 CDD:275380 10/22 (45%)
leucine-rich repeat 376..401 CDD:275380 8/28 (29%)
LRR_RI <401..626 CDD:238064 31/110 (28%)
leucine-rich repeat 402..425 CDD:275380 9/22 (41%)
leucine-rich repeat 426..449 CDD:275380 7/22 (32%)
leucine-rich repeat 450..473 CDD:275380 3/22 (14%)
leucine-rich repeat 474..497 CDD:275380 5/27 (19%)
leucine-rich repeat 498..518 CDD:275380 4/8 (50%)
leucine-rich repeat 521..544 CDD:275380
leucine-rich repeat 545..566 CDD:275380
leucine-rich repeat 569..592 CDD:275380
leucine-rich repeat 593..615 CDD:275380
leucine-rich repeat 616..637 CDD:275380
leucine-rich repeat 638..662 CDD:275380
leucine-rich repeat 663..684 CDD:275380
leucine-rich repeat 685..708 CDD:275380
leucine-rich repeat 709..728 CDD:275380
LRR_8 883..943 CDD:290566
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
LRR_8 932..990 CDD:290566
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587
lrtm2aXP_001923104.1 LRR 44..>201 CDD:227223 48/134 (36%)
leucine-rich repeat 71..93 CDD:275380 6/19 (32%)
leucine-rich repeat 94..117 CDD:275380 10/22 (45%)
leucine-rich repeat 118..141 CDD:275380 10/22 (45%)
leucine-rich repeat 142..165 CDD:275380 8/28 (29%)
leucine-rich repeat 166..189 CDD:275380 9/22 (41%)
PCC 171..>244 CDD:188093 23/86 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45836
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.