DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-6 and Lrrc17

DIOPT Version :10

Sequence 1:NP_524081.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_001020326.1 Gene:Lrrc17 / 502715 RGDID:1560165 Length:446 Species:Rattus norvegicus


Alignment Length:337 Identity:89/337 - (26%)
Similarity:140/337 - (41%) Gaps:79/337 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 LNLSSNKIV-ALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTWIDK 393
            |:....|:| .||     :..:.:..:.|..|.|.||...:||...:|::|||..|:|:.  |:.
  Rat    70 LDCQERKLVYVLP-----DWPQDLLHMLLARNKIRVLKNNMFSKFKRLKSLDLQQNEISK--IES 127

  Fly   394 NTFVGLIRLVLLNLSHNKLTKLEPEIFSDLYT--LQILNLRHN------QLENIAADTFAPMNNL 450
            ..|.||.:|..|.|.||::..|..|:|  :||  |..|.|..|      :||.:.:....|.|  
  Rat   128 EAFFGLNKLTTLLLQHNQIKVLTEEVF--IYTPLLSYLRLYDNPWHCACELETLVSMLQIPRN-- 188

  Fly   451 HTLLLSHNKLKYLDAYALNGLYVLSLLSLDNNALIGVHPDAFRNCSALQDLNLNG-NQLKTVPLA 514
                      :.|..||..|    |..:|.|..|:.:.|...  |...:...|:. .|:..||..
  Rat   189 ----------RNLGNYAKCG----SPPALRNKKLLQLKPQEL--CDEEEKERLDPIPQVSGVPAV 237

  Fly   515 LR-----NMRH-----LRTVDLGENMITVMEDSAFKGLGNLYGLRLIGNYLENITMHTFRDLPNL 569
            :|     .:.|     ::|:|....                 .|:.:.|   ||.       ||:
  Rat   238 IRPEADSTLCHNYVFPIQTLDCKRK-----------------ELKKVPN---NIP-------PNI 275

  Fly   570 QILNLARNRIAVVEPGAFEMTSSIQAVRLDGNELNDIN-GLFSNMPSLLWLNISDNRLESFDYGH 633
            ..|:|:.|:|:.:.|..||....::.:.|..|.|..|: ..|..:..|..|::|:|.|:|||||.
  Rat   276 VKLDLSYNKISQLRPKEFEDVHELKKLNLSSNGLEFIDPAAFLGLIHLEELDLSNNSLQSFDYGV 340

  Fly   634 VPS----TLQWL 641
            :..    .|.||
  Rat   341 LEDLYFLKLLWL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-6NP_524081.1 PPP1R42 <135..>242 CDD:455733
leucine-rich repeat 148..171 CDD:275380
leucine-rich repeat 172..201 CDD:275380
LRR_8 200..>246 CDD:404697
leucine-rich repeat 202..278 CDD:275380
leucine-rich repeat 229..249 CDD:275380
leucine-rich repeat 279..302 CDD:275380
LRR 299..654 CDD:443914 89/337 (26%)
leucine-rich repeat 303..326 CDD:275380
leucine-rich repeat 327..350 CDD:275380 5/20 (25%)
leucine-rich repeat 352..375 CDD:275380 7/22 (32%)
leucine-rich repeat 376..401 CDD:275380 10/24 (42%)
leucine-rich repeat 402..425 CDD:275380 8/22 (36%)
leucine-rich repeat 426..449 CDD:275380 7/28 (25%)
leucine-rich repeat 450..473 CDD:275380 4/22 (18%)
leucine-rich repeat 474..497 CDD:275380 6/22 (27%)
leucine-rich repeat 498..518 CDD:275380 5/25 (20%)
leucine-rich repeat 521..544 CDD:275380 2/22 (9%)
leucine-rich repeat 545..566 CDD:275380 4/20 (20%)
leucine-rich repeat 569..592 CDD:275380 7/22 (32%)
leucine-rich repeat 593..615 CDD:275380 5/22 (23%)
leucine-rich repeat 616..637 CDD:275380 10/24 (42%)
leucine-rich repeat 638..662 CDD:275380 3/4 (75%)
LRR_8 662..719 CDD:404697
leucine-rich repeat 663..684 CDD:275380
leucine-rich repeat 685..708 CDD:275380
leucine-rich repeat 709..728 CDD:275380
LRR <863..>990 CDD:443914
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587
Lrrc17NP_001020326.1 leucine-rich repeat 68..86 CDD:275380 5/20 (25%)
LRR <89..>356 CDD:443914 84/313 (27%)
leucine-rich repeat 89..111 CDD:275380 7/21 (33%)
leucine-rich repeat 112..135 CDD:275380 10/24 (42%)
leucine-rich repeat 136..159 CDD:275380 10/24 (42%)
PCC 141..>247 CDD:188093 31/125 (25%)
leucine-rich repeat 160..210 CDD:275380 16/65 (25%)
leucine-rich repeat 211..274 CDD:275380 14/91 (15%)
leucine-rich repeat 275..298 CDD:275380 7/22 (32%)
leucine-rich repeat 299..322 CDD:275380 5/22 (23%)
leucine-rich repeat 323..346 CDD:275380 10/22 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.