DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-6 and CG5810

DIOPT Version :9

Sequence 1:NP_001246765.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster


Alignment Length:463 Identity:108/463 - (23%)
Similarity:203/463 - (43%) Gaps:99/463 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 SFAHLVRLQQLSIQYCKLGRLGRQVLDGLEQLRNLTLRTHNILWPALNFEIEADAF---SVT--- 199
            ::.:.:.:..::...|:..:|....:|.|:...|...   |:.:|:.:    |.|:   :||   
  Fly     5 NYLNYILIAVIAFATCESQKLEEIAIDSLDCRENTCT---NLKYPSAS----AVAYFSENVTKHL 62

  Fly   200 RRLERLDLSSNNIWSLPDNIFCTLSELSALNMSENRLQDVNELGFRDRSKEPTNGSTESTSTTES 264
            |:.|.|.|.|:::.:||..||..|.:|...::.|..||.:..:.| |.:|     :.:..:...:
  Fly    63 RKYETLVLHSSDLANLPRKIFLNLPQLVEFHVLECELQQIESVCF-DGAK-----NLKRLNFGGN 121

  Fly   265 AKKSSSSST-SCSLDLEYLDVSHNDFVVLPANGFGTLRRLRVLSVNNNGISMIADKALSGLKNLQ 328
            |.:...|:| ..:..||.|::|.|....||...|..|:.|:.::::||.:..::....|.|.:|:
  Fly   122 ALRVLDSNTFELATQLEELNLSDNQLEDLPTTIFRPLKNLQKINLSNNRLITLSQHIFSQLGSLK 186

  Fly   329 ILNLSSNKIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLD--------QLQALDLS--M 383
            .:|:.||::|.||.|||.:|.|.:.|...|:|.:..:...:|..:|        ||:.|.||  :
  Fly   187 SINVDSNQLVELPGELFRDQRKHLSEFSAQSNQLVRIPFNIFREIDHLSLSFNPQLRRLHLSAKI 251

  Fly   384 NQITSTWIDKNTFVGLIRLVLLNLSHN-KLTKL---EPEIFSDLY--------------TLQILN 430
            |::.:|..|..:.....|::.:.|..| ||.:|   :|:....||              ..::::
  Fly   252 NELEATNCDLESVELDGRVIGVQLEANPKLHELKISQPQDLEHLYLANTNLYRLDFLSKASKLVD 316

  Fly   431 LRHNQLENIA--------------ADTFAPMNNLHTLLLSHNK-LKYLDAYALNGLYVLSLLSLD 480
            |....:.|:|              :.|:..:.:.|..:|.|.| |.||:.....|..:. :..||
  Fly   317 LDVTDIVNLADLPKITSAKGLERLSFTYDNLTSNHMDMLPHLKDLNYLEISHEKGKEIF-IKDLD 380

  Fly   481 NNALIGVHPDAFRNCSALQDLNLNGNQLKTVPLALRNMRHLRTVDLGENMITVMEDSAFKGLGNL 545
            .:..:   .:|..||..|.||                   |..|:|.:: .|::||         
  Fly   381 EDFFV---EEAELNCGQLADL-------------------LEFVELPKD-TTILED--------- 413

  Fly   546 YGLRLIGN 553
               ||:|:
  Fly   414 ---RLVGD 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-6NP_001246765.1 leucine-rich repeat 148..171 CDD:275380 4/22 (18%)
LRR_8 171..236 CDD:290566 19/70 (27%)
leucine-rich repeat 172..201 CDD:275380 7/34 (21%)
leucine-rich repeat 202..278 CDD:275380 19/76 (25%)
leucine-rich repeat 229..249 CDD:275380 5/19 (26%)
LRR_RI 278..468 CDD:238064 59/232 (25%)
leucine-rich repeat 279..302 CDD:275380 9/22 (41%)
LRR_8 301..386 CDD:290566 28/94 (30%)
leucine-rich repeat 303..326 CDD:275380 5/22 (23%)
leucine-rich repeat 327..350 CDD:275380 11/22 (50%)
LRR 350..729 CDD:227223 52/247 (21%)
leucine-rich repeat 352..375 CDD:275380 5/30 (17%)
leucine-rich repeat 376..401 CDD:275380 7/26 (27%)
LRR_RI <401..626 CDD:238064 38/186 (20%)
leucine-rich repeat 402..425 CDD:275380 8/40 (20%)
leucine-rich repeat 426..449 CDD:275380 4/36 (11%)
leucine-rich repeat 450..473 CDD:275380 8/23 (35%)
leucine-rich repeat 474..497 CDD:275380 5/22 (23%)
leucine-rich repeat 498..518 CDD:275380 3/19 (16%)
leucine-rich repeat 521..544 CDD:275380 6/22 (27%)
leucine-rich repeat 545..566 CDD:275380 3/9 (33%)
leucine-rich repeat 569..592 CDD:275380
leucine-rich repeat 593..615 CDD:275380
leucine-rich repeat 616..637 CDD:275380
leucine-rich repeat 638..662 CDD:275380
leucine-rich repeat 663..684 CDD:275380
leucine-rich repeat 685..708 CDD:275380
leucine-rich repeat 709..728 CDD:275380
LRR_8 883..943 CDD:290566
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
LRR_8 932..990 CDD:290566
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587
CG5810NP_650952.2 leucine-rich repeat 65..88 CDD:275380 9/22 (41%)
LRR_8 87..147 CDD:290566 15/65 (23%)
leucine-rich repeat 89..112 CDD:275380 7/28 (25%)
leucine-rich repeat 113..136 CDD:275380 3/22 (14%)
LRR_8 135..195 CDD:290566 18/59 (31%)
LRR_4 135..175 CDD:289563 12/39 (31%)
leucine-rich repeat 137..160 CDD:275380 9/22 (41%)
leucine-rich repeat 161..184 CDD:275380 5/22 (23%)
leucine-rich repeat 185..209 CDD:275380 11/23 (48%)
leucine-rich repeat 210..231 CDD:275380 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453653
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.