DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-6 and rtn4r

DIOPT Version :9

Sequence 1:NP_001246765.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_982345.1 Gene:rtn4r / 403306 ZFINID:ZDB-GENE-040310-1 Length:479 Species:Danio rerio


Alignment Length:402 Identity:103/402 - (25%)
Similarity:164/402 - (40%) Gaps:85/402 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 IVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFVGLIR 401
            :.::|||:....    |.::||:|.::|:....||::..|..|.:..|.|:.  |:...|.||.|
Zfish    48 LFSIPTEIPVRS----QRIFLQSNKLTVVRSTSFSSVHNLTVLWMYSNNISH--IEAGAFYGLER 106

  Fly   402 LVLLNLSHNKLTKLEPEIFSDLYTLQILNLRHNQLENIAADTFAPMNNLHTLLLSHNKLKYLDAY 466
            |..|::..|.                  |||     .|:...|..:..||||.|....|..|...
Zfish   107 LEELDIGDNS------------------NLR-----IISPTAFRGLTKLHTLHLHRCGLSELPVG 148

  Fly   467 ALNGLYVLSLLSLDNNALIGVHPDAFRNCSALQDLNLNGNQLKTVPLALRNMRHLRTVDLGENMI 531
            ...||:.|..|.|.:|.|:.:|.|.|.:.:.|..|.|:.|::|                      
Zfish   149 VFRGLFSLQYLYLQDNNLLALHEDTFLDLANLTYLFLHNNKIK---------------------- 191

  Fly   532 TVMEDSAFKGLGNLYGLRLIGNYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFEMTSSIQAV 596
             |:.|...:||.||..|.|..|.:.::....|.||..|..|.|..|.:.::...:.....|:|.:
Zfish   192 -VVTDHMLRGLVNLDRLLLHQNRIVHVQQQAFNDLSKLTTLFLFFNNLTMLTGESMNPLVSLQYL 255

  Fly   597 RLDGNE-LNDINGLFSNMPSLLWLNI---SDNRLESFDYGHVPSTLQWLDLHKNRLSSLSNRFGL 657
            ||:||: :.|...    .|...|...   |.:.||.    |:|::|...||  .||.|......:
Zfish   256 RLNGNQWICDCRA----RPLWDWFKRFKGSSSDLEC----HLPASLNGKDL--KRLKSDDLEGCV 310

  Fly   658 DSELKLQTLDVSFNQLQRIGPSSIPNSIELLFLNDNLITTV--------DPDTFMHKTNLTRVDL 714
            ||..::||  ..||        |..:|.:.|.|:|.|:.::        |..:.:...::.....
Zfish   311 DSPSQVQT--SIFN--------SKVHSGKFLSLDDPLVESIPRCCLSDNDKSSIISSKSIPDPSS 365

  Fly   715 Y-ANQITTLDIK 725
            | :.|||...:|
Zfish   366 YNSRQITNNPLK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-6NP_001246765.1 leucine-rich repeat 148..171 CDD:275380
LRR_8 171..236 CDD:290566
leucine-rich repeat 172..201 CDD:275380
leucine-rich repeat 202..278 CDD:275380
leucine-rich repeat 229..249 CDD:275380
LRR_RI 278..468 CDD:238064 34/130 (26%)
leucine-rich repeat 279..302 CDD:275380
LRR_8 301..386 CDD:290566 13/48 (27%)
leucine-rich repeat 303..326 CDD:275380
leucine-rich repeat 327..350 CDD:275380 3/12 (25%)
LRR 350..729 CDD:227223 100/389 (26%)
leucine-rich repeat 352..375 CDD:275380 7/22 (32%)
leucine-rich repeat 376..401 CDD:275380 8/24 (33%)
LRR_RI <401..626 CDD:238064 57/228 (25%)
leucine-rich repeat 402..425 CDD:275380 3/22 (14%)
leucine-rich repeat 426..449 CDD:275380 5/22 (23%)
leucine-rich repeat 450..473 CDD:275380 9/22 (41%)
leucine-rich repeat 474..497 CDD:275380 8/22 (36%)
leucine-rich repeat 498..518 CDD:275380 5/19 (26%)
leucine-rich repeat 521..544 CDD:275380 4/22 (18%)
leucine-rich repeat 545..566 CDD:275380 5/20 (25%)
leucine-rich repeat 569..592 CDD:275380 4/22 (18%)
leucine-rich repeat 593..615 CDD:275380 6/22 (27%)
leucine-rich repeat 616..637 CDD:275380 6/23 (26%)
leucine-rich repeat 638..662 CDD:275380 8/23 (35%)
leucine-rich repeat 663..684 CDD:275380 5/20 (25%)
leucine-rich repeat 685..708 CDD:275380 5/30 (17%)
leucine-rich repeat 709..728 CDD:275380 5/18 (28%)
LRR_8 883..943 CDD:290566
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
LRR_8 932..990 CDD:290566
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587
rtn4rNP_982345.1 leucine-rich repeat 40..57 CDD:275380 3/8 (38%)
LRR_8 60..115 CDD:290566 18/56 (32%)
leucine-rich repeat 60..82 CDD:275380 7/21 (33%)
leucine-rich repeat 83..106 CDD:275380 8/24 (33%)
leucine-rich repeat 107..131 CDD:275380 8/46 (17%)
leucine-rich repeat 132..155 CDD:275380 9/22 (41%)
LRR_8 155..214 CDD:290566 22/81 (27%)
leucine-rich repeat 156..179 CDD:275380 8/22 (36%)
leucine-rich repeat 180..203 CDD:275380 9/45 (20%)
LRR_8 203..261 CDD:290566 17/57 (30%)
leucine-rich repeat 204..227 CDD:275380 7/22 (32%)
leucine-rich repeat 228..251 CDD:275380 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45836
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.