DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-6 and IL1R1

DIOPT Version :10

Sequence 1:NP_524081.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_000868.1 Gene:IL1R1 / 3554 HGNCID:5993 Length:569 Species:Homo sapiens


Alignment Length:418 Identity:81/418 - (19%)
Similarity:163/418 - (38%) Gaps:93/418 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   900 NTTFSGLK-RLLILHLEDNH--------IISLEGNEFHNLENLRELYLQSNK-----IASIANGS 950
            |..|||:| ||:::::.:.|        ..:..|.::.....:..:.|:.||     |.|.||  
Human   171 NIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPAN-- 233

  Fly   951 FQMLRKLEVLRLD-GNRLMHFEVWQLSANPYLVEISLAD-NQWSCECGYLARFRNYLGQ---SSE 1010
                   |.:.:| |:::      ||..|   |...|:| ..|......:......||:   |.|
Human   234 -------ETMEVDLGSQI------QLICN---VTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVE 282

  Fly  1011 KIIDASRVSCIYNNATSVLRE---KNGTKCTLRDGVAHYMHTNEIEGLLPLL-----LVATCAFV 1067
            ...:..|.:.|.....|.:..   |:...|..::  .|.:....|:.:.|:.     ::..|..:
Human   283 NPANKRRSTLITVLNISEIESRFYKHPFTCFAKN--THGIDAAYIQLIYPVTNFQKHMIGICVTL 345

  Fly  1068 AFFGLIFGLFCY---RHELKIWAHSTNCLMNFCYKSPRFVD-QLDKERPNDAYFAY-------SL 1121
            ... ::..:|.|   :.::.:|...:      ||.   |:. :....:..|||..|       |.
Human   346 TVI-IVCSVFIYKIFKIDIVLWYRDS------CYD---FLPIKASDGKTYDAYILYPKTVGEGST 400

  Fly  1122 QD-EHFVNQILAQTLENDIGYRLCLHYRDVNINAYITDALIEAAESAKQFVLVLSKNFLYNEW-- 1183
            .| :.||.::|.:.||...||:|.::.||..:...|.:.:.|..:.:::.:::|.:......|  
Human   401 SDCDIFVFKVLPEVLEKQCGYKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSGFSWLG 465

  Fly  1184 -SRFEYKSALHELVKRRKRVVFIL------YGDLPQRDIDMDMRHYLRTSTCIEWD--------- 1232
             |..|..:..:.||:...:||.:.      |..:|:....:..:|     ..|.|.         
Human   466 GSSEEQIAMYNALVQDGIKVVLLELEKIQDYEKMPESIKFIKQKH-----GAIRWSGDFTQGPQS 525

  Fly  1233 -DKKFWQKLRLALPLPNGRGNNNKRVVS 1259
             ..:||:.:|..:|:.....::..:::|
Human   526 AKTRFWKNVRYHMPVQRRSPSSKHQLLS 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-6NP_524081.1 PPP1R42 <135..>242 CDD:455733
leucine-rich repeat 148..171 CDD:275380
leucine-rich repeat 172..201 CDD:275380
LRR_8 200..>246 CDD:404697
leucine-rich repeat 202..278 CDD:275380
leucine-rich repeat 229..249 CDD:275380
leucine-rich repeat 279..302 CDD:275380
LRR 299..654 CDD:443914
leucine-rich repeat 303..326 CDD:275380
leucine-rich repeat 327..350 CDD:275380
leucine-rich repeat 352..375 CDD:275380
leucine-rich repeat 376..401 CDD:275380
leucine-rich repeat 402..425 CDD:275380
leucine-rich repeat 426..449 CDD:275380
leucine-rich repeat 450..473 CDD:275380
leucine-rich repeat 474..497 CDD:275380
leucine-rich repeat 498..518 CDD:275380
leucine-rich repeat 521..544 CDD:275380
leucine-rich repeat 545..566 CDD:275380
leucine-rich repeat 569..592 CDD:275380
leucine-rich repeat 593..615 CDD:275380
leucine-rich repeat 616..637 CDD:275380
leucine-rich repeat 638..662 CDD:275380
LRR_8 662..719 CDD:404697
leucine-rich repeat 663..684 CDD:275380
leucine-rich repeat 685..708 CDD:275380
leucine-rich repeat 709..728 CDD:275380
LRR <863..>990 CDD:443914 25/105 (24%)
leucine-rich repeat 885..908 CDD:275380 5/8 (63%)
leucine-rich repeat 909..932 CDD:275380 3/30 (10%)
leucine-rich repeat 933..956 CDD:275380 7/27 (26%)
TIR 1114..1247 CDD:214587 35/159 (22%)
IL1R1NP_000868.1 Ig1_IL1R_like 24..114 CDD:409583
Ig strand A 25..28 CDD:409583
Ig strand A' 31..35 CDD:409583
Ig strand B 39..44 CDD:409583
Ig strand C 54..58 CDD:409583
Ig strand C' 63..65 CDD:409583
Ig strand D 73..77 CDD:409583
Ig strand E 79..83 CDD:409583
Ig strand F 92..100 CDD:409583
Ig strand G 103..114 CDD:409583
Ig2_IL1R_like 126..219 CDD:409586 9/47 (19%)
Ig strand A 128..133 CDD:409586
Ig strand B 138..142 CDD:409586
Ig strand C 157..162 CDD:409586
Ig strand C' 165..167 CDD:409586
Ig strand D 173..177 CDD:409586 2/3 (67%)
Ig strand E 179..184 CDD:409586 2/4 (50%)
Ig strand F 193..202 CDD:409586 0/8 (0%)
Ig strand G 205..218 CDD:409586 0/12 (0%)
Ig3_IL1R_like 226..329 CDD:409526 25/122 (20%)
Ig strand A 226..229 CDD:409526 0/2 (0%)
Ig strand A' 234..237 CDD:409526 1/2 (50%)
Ig strand B 242..251 CDD:409526 3/17 (18%)
Ig strand C 256..262 CDD:409526 2/5 (40%)
Ig strand C' 264..267 CDD:409526 0/2 (0%)
Ig strand D 273..282 CDD:409526 3/8 (38%)
Ig strand E 290..298 CDD:409526 1/7 (14%)
Ig strand F 309..316 CDD:409526 1/6 (17%)
Ig strand G 319..329 CDD:409526 1/9 (11%)
TIR 384..540 CDD:214587 34/160 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.