Sequence 1: | NP_001246765.1 | Gene: | Toll-6 / 39663 | FlyBaseID: | FBgn0036494 | Length: | 1514 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004479.1 | Gene: | GP5 / 2814 | HGNCID: | 4443 | Length: | 560 | Species: | Homo sapiens |
Alignment Length: | 382 | Identity: | 119/382 - (31%) |
---|---|---|---|
Similarity: | 179/382 - (46%) | Gaps: | 34/382 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 291 VLPANGFGTLRRLRVLSVNNNGISMIADKALSGLKNLQILNLSSNKIVALP----------TELF 345
Fly 346 AEQAKI-------------IQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFV 397
Fly 398 GLIRLVLLNLSHNKLTKLEPEIFSDLYTLQILNLRHNQLENIAADTFAPMNNLHTLLLSHNKLKY 462
Fly 463 LDAYALNGLYVLSLLSLDNNALIGVHPDAFRNCSALQDLNLNGNQLKTVP-LALRNMRHLRTVDL 526
Fly 527 GENM---ITVMEDSAFKGLGNLYGLRLIGNYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFE 588
Fly 589 MTSSIQAVRLDGNELNDING-LFSNMPSLLWLNISDNRLESFDYGHVPSTLQWLDLH 644 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Toll-6 | NP_001246765.1 | leucine-rich repeat | 148..171 | CDD:275380 | |
LRR_8 | 171..236 | CDD:290566 | |||
leucine-rich repeat | 172..201 | CDD:275380 | |||
leucine-rich repeat | 202..278 | CDD:275380 | |||
leucine-rich repeat | 229..249 | CDD:275380 | |||
LRR_RI | 278..468 | CDD:238064 | 59/199 (30%) | ||
leucine-rich repeat | 279..302 | CDD:275380 | 3/10 (30%) | ||
LRR_8 | 301..386 | CDD:290566 | 33/107 (31%) | ||
leucine-rich repeat | 303..326 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 327..350 | CDD:275380 | 11/32 (34%) | ||
LRR | 350..729 | CDD:227223 | 98/313 (31%) | ||
leucine-rich repeat | 352..375 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 376..401 | CDD:275380 | 8/24 (33%) | ||
LRR_RI | <401..626 | CDD:238064 | 74/229 (32%) | ||
leucine-rich repeat | 402..425 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 426..449 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 450..473 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 474..497 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 498..518 | CDD:275380 | 11/20 (55%) | ||
leucine-rich repeat | 521..544 | CDD:275380 | 8/25 (32%) | ||
leucine-rich repeat | 545..566 | CDD:275380 | 6/20 (30%) | ||
leucine-rich repeat | 569..592 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 593..615 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 616..637 | CDD:275380 | 5/20 (25%) | ||
leucine-rich repeat | 638..662 | CDD:275380 | 4/7 (57%) | ||
leucine-rich repeat | 663..684 | CDD:275380 | |||
leucine-rich repeat | 685..708 | CDD:275380 | |||
leucine-rich repeat | 709..728 | CDD:275380 | |||
LRR_8 | 883..943 | CDD:290566 | |||
leucine-rich repeat | 885..908 | CDD:275380 | |||
leucine-rich repeat | 909..932 | CDD:275380 | |||
LRR_8 | 932..990 | CDD:290566 | |||
leucine-rich repeat | 933..956 | CDD:275380 | |||
TIR | 1114..1247 | CDD:214587 | |||
GP5 | NP_004479.1 | LRR 1 | 75..96 | 5/20 (25%) | |
LRR_RI | <76..230 | CDD:238064 | 45/155 (29%) | ||
LRR_8 | 76..134 | CDD:290566 | 18/57 (32%) | ||
leucine-rich repeat | 76..99 | CDD:275380 | 7/22 (32%) | ||
LRR 2 | 99..120 | 9/20 (45%) | |||
leucine-rich repeat | 100..123 | CDD:275380 | 9/22 (41%) | ||
LRR 3 | 123..144 | 2/20 (10%) | |||
leucine-rich repeat | 124..147 | CDD:275380 | 2/22 (9%) | ||
LRR_8 | 147..206 | CDD:290566 | 21/60 (35%) | ||
LRR 4 | 147..168 | 7/20 (35%) | |||
leucine-rich repeat | 148..171 | CDD:275380 | 9/22 (41%) | ||
LRR_RI | 163..400 | CDD:238064 | 80/240 (33%) | ||
LRR 5 | 171..193 | 8/23 (35%) | |||
leucine-rich repeat | 172..195 | CDD:275380 | 8/24 (33%) | ||
LRR_8 | 195..254 | CDD:290566 | 19/58 (33%) | ||
LRR 6 | 195..216 | 6/20 (30%) | |||
leucine-rich repeat | 196..219 | CDD:275380 | 7/22 (32%) | ||
LRR 7 | 219..240 | 6/20 (30%) | |||
leucine-rich repeat | 220..243 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 242..302 | CDD:290566 | 20/59 (34%) | ||
LRR 8 | 243..264 | 8/20 (40%) | |||
leucine-rich repeat | 244..267 | CDD:275380 | 7/22 (32%) | ||
LRR 9 | 267..288 | 7/20 (35%) | |||
leucine-rich repeat | 268..291 | CDD:275380 | 7/22 (32%) | ||
LRR 10 | 291..312 | 10/20 (50%) | |||
leucine-rich repeat | 292..315 | CDD:275380 | 12/22 (55%) | ||
LRR_8 | 314..375 | CDD:290566 | 20/62 (32%) | ||
leucine-rich repeat | 316..338 | CDD:275380 | 6/23 (26%) | ||
LRR 11 | 340..361 | 5/20 (25%) | |||
leucine-rich repeat | 341..364 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 364..421 | CDD:290566 | 17/56 (30%) | ||
LRR 12 | 364..385 | 6/20 (30%) | |||
leucine-rich repeat | 365..388 | CDD:275380 | 6/22 (27%) | ||
LRR 13 | 388..409 | 8/20 (40%) | |||
leucine-rich repeat | 389..410 | CDD:275380 | 7/20 (35%) | ||
LRRCT | 421..472 | CDD:214507 | 8/21 (38%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 469..498 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | mtm8435 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |