DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-6 and Lrrc15

DIOPT Version :10

Sequence 1:NP_524081.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_659551.2 Gene:Lrrc15 / 246296 RGDID:70551 Length:578 Species:Rattus norvegicus


Alignment Length:454 Identity:131/454 - (28%)
Similarity:209/454 - (46%) Gaps:90/454 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 KIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFVGLI 400
            :|||:||.|                              ...|:.|.:.....|.:.:|.|:.:.
  Rat    43 RIVAMPTPL------------------------------PWNAMSLQVVNTHITELPENLFLNIS 77

  Fly   401 RLVLLNLSHNKLTKLEPEIFSDLYTLQILNLRHNQLENIAADTFAPMNNLHTLLLSHNKLKYLDA 465
            .|:.|.:..|:|:.:.|..|.:|.:|:.|:|.:|:|..:....|..:|||.:||||         
  Rat    78 ALIALKMEKNELSTIMPGAFRNLGSLRYLSLANNKLRMLPIRVFQDVNNLESLLLS--------- 133

  Fly   466 YALNGLYVLSLLSLDNNALIGVHPDAFRNCSALQDLNLNGNQLKTVP-LALRNMRHLRTVDLGEN 529
                           ||.|:.:.|..|...|.|::|.|:||.|:::| .|..::..|..::||.|
  Rat   134 ---------------NNQLVQIQPAQFSQFSNLRELQLHGNNLESIPEEAFDHLVGLTKLNLGRN 183

  Fly   530 MITVMEDSAFKGLGNLYGLRLIGNYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFEMTSSIQ 594
            ..|.:....|:.||||..|||..|.|.:|.|.||..|.|||.|.|..|:|..:.||.|....::|
  Rat   184 SFTHLSPRLFQHLGNLQVLRLHENRLSDIPMGTFDALGNLQELALQENQIGTLSPGLFHNNRNLQ 248

  Fly   595 AVRLDGNELNDI-NGLFSNMPSLLWLNISDNRLESFD---YGHVPSTLQWLDLHKNRLSSLS-NR 654
            .:.|..|.::.: .|:|..:|.|..|.:..|.|....   :|.:|: |:.|.|:.|.::||: |.
  Rat   249 RLYLSNNHISQLPPGIFMQLPQLNKLTLFGNSLRELSPGVFGPMPN-LRELWLYNNHITSLADNT 312

  Fly   655 FGLDSEL-KLQTLDVSFNQLQRIGPSSIPNSIEL--LFLNDNLITTVDPDTFMHKTNLTRVDLYA 716
            |   |.| :||.|.:|.|||..|.|.:......|  |.|:.|.:..:|.:.|....||..:.|.:
  Rat   313 F---SHLNQLQVLILSHNQLTYISPGAFNGLTNLRELSLHTNALQDLDSNVFRSLANLQNISLQS 374

  Fly   717 NQ--------------ITTLDIK--SLRILP--VWEHRA-LPEFYIGGNPFTCDCNI----DWL 757
            |:              :||:.::  :|..||  :::|.. |.|..:..||:.||.:|    :||
  Rat   375 NRLRQLPGSIFANVNGLTTIQLQNNNLENLPLGIFDHLVNLCELRLYDNPWRCDSDILPLHNWL 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-6NP_524081.1 PPP1R42 <135..>242 CDD:455733
leucine-rich repeat 148..171 CDD:275380
leucine-rich repeat 172..201 CDD:275380
LRR_8 200..>246 CDD:404697
leucine-rich repeat 202..278 CDD:275380
leucine-rich repeat 229..249 CDD:275380
leucine-rich repeat 279..302 CDD:275380
LRR 299..654 CDD:443914 93/323 (29%)
leucine-rich repeat 303..326 CDD:275380
leucine-rich repeat 327..350 CDD:275380 6/13 (46%)
leucine-rich repeat 352..375 CDD:275380 0/22 (0%)
leucine-rich repeat 376..401 CDD:275380 5/24 (21%)
leucine-rich repeat 402..425 CDD:275380 7/22 (32%)
leucine-rich repeat 426..449 CDD:275380 6/22 (27%)
leucine-rich repeat 450..473 CDD:275380 5/22 (23%)
leucine-rich repeat 474..497 CDD:275380 5/22 (23%)
leucine-rich repeat 498..518 CDD:275380 8/20 (40%)
leucine-rich repeat 521..544 CDD:275380 7/22 (32%)
leucine-rich repeat 545..566 CDD:275380 10/20 (50%)
leucine-rich repeat 569..592 CDD:275380 9/22 (41%)
leucine-rich repeat 593..615 CDD:275380 5/22 (23%)
leucine-rich repeat 616..637 CDD:275380 6/23 (26%)
leucine-rich repeat 638..662 CDD:275380 10/25 (40%)
LRR_8 662..719 CDD:404697 19/72 (26%)
leucine-rich repeat 663..684 CDD:275380 9/20 (45%)
leucine-rich repeat 685..708 CDD:275380 6/24 (25%)
leucine-rich repeat 709..728 CDD:275380 5/34 (15%)
LRR <863..>990 CDD:443914
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587
Lrrc15NP_659551.2 LRR 1 54..75 5/20 (25%)
LRR 65..425 CDD:443914 117/387 (30%)
LRR 2 78..99 6/20 (30%)
leucine-rich repeat 79..102 CDD:275380 7/22 (32%)
LRR 3 102..123 6/20 (30%)
leucine-rich repeat 103..126 CDD:275380 6/22 (27%)
LRR 4 126..147 11/44 (25%)
leucine-rich repeat 127..150 CDD:275380 10/46 (22%)
LRR 5 150..171 8/20 (40%)
leucine-rich repeat 151..174 CDD:275380 8/22 (36%)
LRR 6 174..195 6/20 (30%)
leucine-rich repeat 175..198 CDD:275380 7/22 (32%)
LRR 7 198..219 11/20 (55%)
leucine-rich repeat 199..222 CDD:275380 11/22 (50%)
LRR 8 222..243 10/20 (50%)
leucine-rich repeat 223..246 CDD:275380 9/22 (41%)
LRR 9 246..267 5/20 (25%)
leucine-rich repeat 247..270 CDD:275380 5/22 (23%)
LRR 10 270..291 4/20 (20%)
leucine-rich repeat 271..294 CDD:275380 5/22 (23%)
LRR 11 294..315 8/24 (33%)
leucine-rich repeat 295..318 CDD:275380 10/25 (40%)
LRR 12 318..339 9/20 (45%)
leucine-rich repeat 319..342 CDD:275380 9/22 (41%)
LRR 13 342..363 6/20 (30%)
leucine-rich repeat 343..364 CDD:275380 6/20 (30%)
LRR 14 366..387 4/20 (20%)
leucine-rich repeat 367..387 CDD:275380 3/19 (16%)
LRR 15 390..411 5/20 (25%)
leucine-rich repeat 391..412 CDD:275380 5/20 (25%)
PCC 396..>469 CDD:188093 13/43 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..500
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.