DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-6 and Tsku

DIOPT Version :10

Sequence 1:NP_524081.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_001019790.1 Gene:Tsku / 244152 MGIID:2443855 Length:354 Species:Mus musculus


Alignment Length:262 Identity:76/262 - (29%)
Similarity:132/262 - (50%) Gaps:27/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 LDLSMNQITSTWIDKNTFV--GLIRLVLLNLSHNKLTKLEPEIFSDLYTLQILNLRHNQLENIAA 441
            ||||.|::.:  ::::...  |...|..|:||:|.||.:.|..||.|..|:.|:|.||.|..:.|
Mouse    64 LDLSSNRLET--VNESVLAGPGYTTLAGLDLSYNLLTSIMPSAFSRLRYLESLDLSHNGLAALPA 126

  Fly   442 DTF--APMNNLHTLLLSHNKLKYLDAYAL------NGLYVLSLLSLDNNALIGVHPDAFR---NC 495
            :.|  :|:::::   ||||:|:.:...|.      ..|:|    .|.:|.:..:.|...|   ..
Mouse   127 EIFTSSPLSDIN---LSHNRLREVSISAFTTHSQGRALHV----DLSHNLIHRLLPHPARASLPA 184

  Fly   496 SALQDLNLNGNQLKTVPLALRNMRHLRTVDLGENMITVMEDSAFKGLGNLYGLRLIG-NYLENIT 559
            ..:|.|||:.|:.:.|| .||:: .||.:.|..|.:..:...||.||..|..|.|.. ..:.::.
Mouse   185 PTIQSLNLSWNRFRAVP-DLRDL-PLRYLSLDGNPLATINPDAFMGLAGLTHLSLASLQGILHLP 247

  Fly   560 MHTFRDLPNLQILNLARN-RIAVVEPGAFEMTSSIQAVRLDGNELNDI-NGLFSNMPSLLWLNIS 622
            .|.||:||.||:|:|:.| ::.......|.....:|.:.|.|:.|..: ..|..::|:|..:::.
Mouse   248 PHGFRELPGLQVLDLSGNPKLKWAGAEVFSGLGLLQELDLSGSSLVPLPEMLLHHLPALQSVSVG 312

  Fly   623 DN 624
            .:
Mouse   313 QD 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-6NP_524081.1 PPP1R42 <135..>242 CDD:455733
leucine-rich repeat 148..171 CDD:275380
leucine-rich repeat 172..201 CDD:275380
LRR_8 200..>246 CDD:404697
leucine-rich repeat 202..278 CDD:275380
leucine-rich repeat 229..249 CDD:275380
leucine-rich repeat 279..302 CDD:275380
LRR 299..654 CDD:443914 76/262 (29%)
leucine-rich repeat 303..326 CDD:275380
leucine-rich repeat 327..350 CDD:275380
leucine-rich repeat 352..375 CDD:275380
leucine-rich repeat 376..401 CDD:275380 6/23 (26%)
leucine-rich repeat 402..425 CDD:275380 11/22 (50%)
leucine-rich repeat 426..449 CDD:275380 9/24 (38%)
leucine-rich repeat 450..473 CDD:275380 7/28 (25%)
leucine-rich repeat 474..497 CDD:275380 4/25 (16%)
leucine-rich repeat 498..518 CDD:275380 9/19 (47%)
leucine-rich repeat 521..544 CDD:275380 8/22 (36%)
leucine-rich repeat 545..566 CDD:275380 6/21 (29%)
leucine-rich repeat 569..592 CDD:275380 6/23 (26%)
leucine-rich repeat 593..615 CDD:275380 5/22 (23%)
leucine-rich repeat 616..637 CDD:275380 1/9 (11%)
leucine-rich repeat 638..662 CDD:275380
LRR_8 662..719 CDD:404697
leucine-rich repeat 663..684 CDD:275380
leucine-rich repeat 685..708 CDD:275380
leucine-rich repeat 709..728 CDD:275380
LRR <863..>990 CDD:443914
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587
TskuNP_001019790.1 LRR 1 60..81 5/18 (28%)
leucine-rich repeat 63..86 CDD:275380 6/23 (26%)
LRR <85..>300 CDD:443914 67/223 (30%)
LRR 2 86..107 9/20 (45%)
leucine-rich repeat 87..110 CDD:275380 11/22 (50%)
LRR 3 110..131 8/20 (40%)
leucine-rich repeat 111..132 CDD:275380 8/20 (40%)
LRR 4 133..154 7/23 (30%)
leucine-rich repeat 134..186 CDD:275380 12/58 (21%)
leucine-rich repeat 158..182 CDD:275380 6/27 (22%)
LRR 5 160..180 5/23 (22%)
LRR 6 186..207 9/22 (41%)
leucine-rich repeat 187..205 CDD:275380 8/18 (44%)
leucine-rich repeat 208..231 CDD:275380 8/22 (36%)
LRR 7 208..228 6/19 (32%)
LRR 8 231..253 5/21 (24%)
leucine-rich repeat 232..256 CDD:275380 7/23 (30%)
LRR 9 256..277 5/20 (25%)
leucine-rich repeat 257..281 CDD:275380 6/23 (26%)
LRR 10 281..302 5/20 (25%)
leucine-rich repeat 282..305 CDD:275380 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.