DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-6 and FBXL14

DIOPT Version :9

Sequence 1:NP_001246765.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_689654.1 Gene:FBXL14 / 144699 HGNCID:28624 Length:418 Species:Homo sapiens


Alignment Length:536 Identity:133/536 - (24%)
Similarity:194/536 - (36%) Gaps:178/536 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 HILCNDEIMAKSRLEAQSFAHL-VRLQQLSIQYCKLGR---LGRQVLDGLEQLRNLTLRTHNILW 184
            ||.|     ....|.|..|.:| ||.:..:.|.|...|   ..:.|..|:|...:|. |.:..|:
Human     4 HISC-----LFPELLAMIFGYLDVRDKGRAAQVCTAWRDAAYHKSVWRGVEAKLHLR-RANPSLF 62

  Fly   185 PALNFE--IEADAFSVTRRLERLDLSSNNIWSLPDNIFCTLSELSALNMSENRLQD--VNELGFR 245
            |:|...  ......|:.|.|..:.....||.||      .||  ...|:::|.|..  |.|:|  
Human    63 PSLQARGIRRVQILSLRRSLSYVIQGMANIESL------NLS--GCYNLTDNGLGHAFVQEIG-- 117

  Fly   246 DRSKEPTNGSTESTSTTESAKKSSSSSTSCSLDLEYLDVSHNDFVVLPANGFGTLRRLRVLSVNN 310
              |....|.|.....|..|..:.:          :||    ....||...|..        ::.|
Human   118 --SLRALNLSLCKQITDSSLGRIA----------QYL----KGLEVLELGGCS--------NITN 158

  Fly   311 NGISMIADKALSGLKNLQILNLSSNK--------IVALPTELFAEQAKIIQEVYLQNNSISVLNP 367
            .|:.:||    .||:.|:.|||.|.:        .:|..|...||....::::.||         
Human   159 TGLLLIA----WGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQ--------- 210

  Fly   368 QLFSNLDQLQALDLSMNQITSTWIDKNTFVGLIRLVLLNLS-----------HNKLTKLEPEIFS 421
                  |..:..|||:..|:.         ||..|.|||||           |          .|
Human   211 ------DCQKLTDLSLKHISR---------GLTGLRLLNLSFCGGISDAGLLH----------LS 250

  Fly   422 DLYTLQILNLRHNQLENIAADTFAPMNNLHTLLLSHNKLKYLD-------AYALNGLYVLSLLSL 479
            .:.:|:.||||  ..:|| :||......:.:|.||...:.:.|       ||...||..|..|||
Human   251 HMGSLRSLNLR--SCDNI-SDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSL 312

  Fly   480 DNNALIGVHPDAFRNCSA-LQDLNLNGNQLKTVPLALRNMRHLRTVDLGENMITVMEDSAFKGLG 543
                           ||. :.|..:|        ..:|.|..|||:::|: .:.:.:    |||.
Human   313 ---------------CSCHISDDGIN--------RMVRQMHGLRTLNIGQ-CVRITD----KGLE 349

  Fly   544 ------------NLYG-LRLIGNYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFEMTSSIQA 595
                        :||| .|:....||.||     .||.|::|||          |.::||.|.:.
Human   350 LIAEHLSQLTGIDLYGCTRITKRGLERIT-----QLPCLKVLNL----------GLWQMTDSEKE 399

  Fly   596 VRLDGNELNDINGLFS 611
            .|      .|.:.||:
Human   400 AR------GDFSPLFT 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-6NP_001246765.1 leucine-rich repeat 148..171 CDD:275380 5/25 (20%)
LRR_8 171..236 CDD:290566 16/66 (24%)
leucine-rich repeat 172..201 CDD:275380 6/30 (20%)
leucine-rich repeat 202..278 CDD:275380 18/77 (23%)
leucine-rich repeat 229..249 CDD:275380 6/21 (29%)
LRR_RI 278..468 CDD:238064 52/215 (24%)
leucine-rich repeat 279..302 CDD:275380 5/22 (23%)
LRR_8 301..386 CDD:290566 21/92 (23%)
leucine-rich repeat 303..326 CDD:275380 6/22 (27%)
leucine-rich repeat 327..350 CDD:275380 9/30 (30%)
LRR 350..729 CDD:227223 73/294 (25%)
leucine-rich repeat 352..375 CDD:275380 2/22 (9%)
leucine-rich repeat 376..401 CDD:275380 6/24 (25%)
LRR_RI <401..626 CDD:238064 64/243 (26%)
leucine-rich repeat 402..425 CDD:275380 8/33 (24%)
leucine-rich repeat 426..449 CDD:275380 9/22 (41%)
leucine-rich repeat 450..473 CDD:275380 8/29 (28%)
leucine-rich repeat 474..497 CDD:275380 5/22 (23%)
leucine-rich repeat 498..518 CDD:275380 3/19 (16%)
leucine-rich repeat 521..544 CDD:275380 7/34 (21%)
leucine-rich repeat 545..566 CDD:275380 8/21 (38%)
leucine-rich repeat 569..592 CDD:275380 7/22 (32%)
leucine-rich repeat 593..615 CDD:275380 4/19 (21%)
leucine-rich repeat 616..637 CDD:275380
leucine-rich repeat 638..662 CDD:275380
leucine-rich repeat 663..684 CDD:275380
leucine-rich repeat 685..708 CDD:275380
leucine-rich repeat 709..728 CDD:275380
LRR_8 883..943 CDD:290566
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
LRR_8 932..990 CDD:290566
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587
FBXL14NP_689654.1 Required for down-regulation of SNAI1 2..48 13/48 (27%)
F-box-like 5..46 CDD:403981 12/45 (27%)
AMN1 90..296 CDD:187754 67/280 (24%)
leucine-rich repeat 92..118 CDD:275381 11/37 (30%)
leucine-rich repeat 119..142 CDD:275381 4/32 (13%)
LRR 1 144..163 5/26 (19%)
leucine-rich repeat 145..170 CDD:275381 9/36 (25%)
LRR 2 170..191 5/20 (25%)
leucine-rich repeat 171..203 CDD:275381 9/31 (29%)
LRR 3 203..225 7/36 (19%)
leucine-rich repeat 204..229 CDD:275381 9/48 (19%)
AMN1 228..401 CDD:187754 60/228 (26%)
LRR 4 229..250 7/30 (23%)
leucine-rich repeat 230..254 CDD:275381 8/33 (24%)
LRR 5 254..275 9/23 (39%)
leucine-rich repeat 255..280 CDD:275381 9/27 (33%)
leucine-rich repeat 281..306 CDD:275381 7/24 (29%)
leucine-rich repeat 307..331 CDD:275381 10/46 (22%)
leucine-rich repeat 332..357 CDD:275381 7/29 (24%)
leucine-rich repeat 358..382 CDD:275381 9/28 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.