DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-6 and lrtm2b

DIOPT Version :9

Sequence 1:NP_001246765.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster
Sequence 2:XP_005163087.1 Gene:lrtm2b / 101887010 ZFINID:ZDB-GENE-131121-544 Length:408 Species:Danio rerio


Alignment Length:251 Identity:80/251 - (31%)
Similarity:113/251 - (45%) Gaps:32/251 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 SSSSSTSCSLDLEYLDVSHNDFVVLPANGFGTLRRLRVLSVNNNGISMIADKALSGLK-NLQILN 331
            |.|....||.::...|.||             |.:|..|           |..|..|. :...||
Zfish    19 SKSCPLLCSCNINQTDCSH-------------LYQLASL-----------DSILEQLPFDTTNLN 59

  Fly   332 LSSNKIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTF 396
            ||.|....:....|:..:.::|..| ..|.:|.:||..||||..|..||||.|.::..:  .::|
Zfish    60 LSKNNFTTVEPGSFSNLSALLQLDY-SRNLLSAINPGCFSNLSGLLHLDLSRNLLSRVF--PSSF 121

  Fly   397 VGLIRLVLLNLSHNKLTKLEPEIFSDLYTLQILNLRHNQLENIAADTFAPMNNLHTLLLSHNKLK 461
            ..|..|..|:||.|.|.:|...:||||.:|..|.||.|:|:.:....|..:..|..|.||.|.|.
Zfish   122 SHLNSLEFLDLSVNLLVRLPVNLFSDLSSLNELVLRDNRLKELNPAQFKGLTELRRLDLSLNSLS 186

  Fly   462 YLDAYALNGLYVLSLLSLDNNALIGVHPDAFRNCSALQDLNLNGN----QLKTVPL 513
            ::..:.|:||..|..|||..|.|..:...:..:.:|||.|.|.||    ..|.:||
Zfish   187 HVPTHLLDGLQNLLWLSLVGNKLKTLDRSSLESANALQQLLLEGNPWNCNCKLIPL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-6NP_001246765.1 leucine-rich repeat 148..171 CDD:275380
LRR_8 171..236 CDD:290566
leucine-rich repeat 172..201 CDD:275380
leucine-rich repeat 202..278 CDD:275380 4/9 (44%)
leucine-rich repeat 229..249 CDD:275380
LRR_RI 278..468 CDD:238064 57/190 (30%)
leucine-rich repeat 279..302 CDD:275380 4/22 (18%)
LRR_8 301..386 CDD:290566 27/85 (32%)
leucine-rich repeat 303..326 CDD:275380 5/23 (22%)
leucine-rich repeat 327..350 CDD:275380 6/22 (27%)
LRR 350..729 CDD:227223 61/168 (36%)
leucine-rich repeat 352..375 CDD:275380 10/22 (45%)
leucine-rich repeat 376..401 CDD:275380 8/24 (33%)
LRR_RI <401..626 CDD:238064 43/117 (37%)
leucine-rich repeat 402..425 CDD:275380 11/22 (50%)
leucine-rich repeat 426..449 CDD:275380 7/22 (32%)
leucine-rich repeat 450..473 CDD:275380 9/22 (41%)
leucine-rich repeat 474..497 CDD:275380 6/22 (27%)
leucine-rich repeat 498..518 CDD:275380 9/20 (45%)
leucine-rich repeat 521..544 CDD:275380
leucine-rich repeat 545..566 CDD:275380
leucine-rich repeat 569..592 CDD:275380
leucine-rich repeat 593..615 CDD:275380
leucine-rich repeat 616..637 CDD:275380
leucine-rich repeat 638..662 CDD:275380
leucine-rich repeat 663..684 CDD:275380
leucine-rich repeat 685..708 CDD:275380
leucine-rich repeat 709..728 CDD:275380
LRR_8 883..943 CDD:290566
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
LRR_8 932..990 CDD:290566
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587
lrtm2bXP_005163087.1 leucine-rich repeat 34..54 CDD:275380 9/43 (21%)
leucine-rich repeat 55..78 CDD:275380 6/22 (27%)
LRR_8 56..113 CDD:290566 22/57 (39%)
leucine-rich repeat 79..102 CDD:275380 10/23 (43%)
Allexi_40kDa 97..>215 CDD:253247 45/119 (38%)
LRR_8 101..161 CDD:290566 24/61 (39%)
leucine-rich repeat 103..126 CDD:275380 8/24 (33%)
leucine-rich repeat 127..150 CDD:275380 11/22 (50%)
LRR_8 149..209 CDD:290566 21/59 (36%)
leucine-rich repeat 151..174 CDD:275380 7/22 (32%)
leucine-rich repeat 175..198 CDD:275380 9/22 (41%)
leucine-rich repeat 199..222 CDD:275380 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45836
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.