DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-6 and lrrc17

DIOPT Version :9

Sequence 1:NP_001246765.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster
Sequence 2:XP_004913080.1 Gene:lrrc17 / 101732309 XenbaseID:XB-GENE-1010987 Length:428 Species:Xenopus tropicalis


Alignment Length:447 Identity:109/447 - (24%)
Similarity:162/447 - (36%) Gaps:118/447 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 FCTLSELSALNMSENRLQDVNELGFRDRSKEPTNGSTESTSTTESAKKSSSSSTSCS----LDLE 280
            ||.:||.                  |.......||....|..|.|..|..:....|.    |:.:
 Frog    12 FCKISEC------------------RKTKSNRENGKPNRTKKTSSTVKRYAPGLPCETYIYLNEK 58

  Fly   281 YLDVSHNDFVVLPANGFGTLRRLRVLSVNNNGISMIADKALSGLKNLQILNLSSNKIVALPTELF 345
            |||....             |:..||.                               |.|.:|.
 Frog    59 YLDCQEK-------------RQTSVLP-------------------------------AWPEDLI 79

  Fly   346 AEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFVGLIRLVLLNLSHN 410
                    .:.|..|.|.:|....||...::::|||..|:|..  |:...|.||.||..|.|.||
 Frog    80 --------HILLARNLIRILKNNAFSKFQKVKSLDLQQNEIIK--IENLAFYGLKRLTTLLLQHN 134

  Fly   411 KLTKLEPEIFSDLYTLQILNLRHN------QLENIAADTFAPMN-NLHTLLLSHNKLKYLDAYAL 468
            |:..|..|:|..|..|..|.|..|      :||::......|.| ||      .|..|......:
 Frog   135 KIKVLSEEVFIHLPLLSYLRLYDNPWDCNCELESLVTLLKIPRNRNL------GNYAKCETPIEM 193

  Fly   469 NGLYVLSLLSLDNNALIGVHPDAFRNCSALQDLNLNGNQLKTVPLALRNMRH-----LRTVDL-G 527
            .||           .|..|.|:.......::..::.|.:: |.|:...::.|     :.|:|. .
 Frog   194 KGL-----------KLKTVSPELICQDRTMEPQHIEGPKV-TRPIVDSSLCHTYLYPVATLDCRR 246

  Fly   528 ENMITVMEDSAFKGLGNLYGLRLIGNYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFEMTSS 592
            :.:.:|..|.|    .::..|.|..|.::.:....|.|.|||:||||..|.|.:::|.||....:
 Frog   247 KELHSVPTDIA----PDIVKLDLSNNKIKQLQSRQFVDTPNLEILNLNSNGIELIDPAAFSGLMN 307

  Fly   593 IQAVRLDGNELNDIN-GLFSNMPSL--LWLNISDNRLESFDYGHVPSTLQWLDLHKN 646
            :|.:.|..|.|..|: |:..::..|  |||.  ||.... || ::.....||..|.|
 Frog   308 LQELDLSNNTLFYIHYGVLEDLYFLKKLWLR--DNPWRC-DY-NIHYLFYWLKHHYN 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-6NP_001246765.1 leucine-rich repeat 148..171 CDD:275380
LRR_8 171..236 CDD:290566 4/15 (27%)
leucine-rich repeat 172..201 CDD:275380
leucine-rich repeat 202..278 CDD:275380 12/61 (20%)
leucine-rich repeat 229..249 CDD:275380 1/19 (5%)
LRR_RI 278..468 CDD:238064 47/196 (24%)
leucine-rich repeat 279..302 CDD:275380 3/22 (14%)
LRR_8 301..386 CDD:290566 16/84 (19%)
leucine-rich repeat 303..326 CDD:275380 2/22 (9%)
leucine-rich repeat 327..350 CDD:275380 3/22 (14%)
LRR 350..729 CDD:227223 87/313 (28%)
leucine-rich repeat 352..375 CDD:275380 6/22 (27%)
leucine-rich repeat 376..401 CDD:275380 9/24 (38%)
LRR_RI <401..626 CDD:238064 66/240 (28%)
leucine-rich repeat 402..425 CDD:275380 10/22 (45%)
leucine-rich repeat 426..449 CDD:275380 8/29 (28%)
leucine-rich repeat 450..473 CDD:275380 5/22 (23%)
leucine-rich repeat 474..497 CDD:275380 3/22 (14%)
leucine-rich repeat 498..518 CDD:275380 3/19 (16%)
leucine-rich repeat 521..544 CDD:275380 5/23 (22%)
leucine-rich repeat 545..566 CDD:275380 4/20 (20%)
leucine-rich repeat 569..592 CDD:275380 10/22 (45%)
leucine-rich repeat 593..615 CDD:275380 6/22 (27%)
leucine-rich repeat 616..637 CDD:275380 8/22 (36%)
leucine-rich repeat 638..662 CDD:275380 4/9 (44%)
leucine-rich repeat 663..684 CDD:275380
leucine-rich repeat 685..708 CDD:275380
leucine-rich repeat 709..728 CDD:275380
LRR_8 883..943 CDD:290566
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
LRR_8 932..990 CDD:290566
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587
lrrc17XP_004913080.1 leucine-rich repeat 58..77 CDD:275380 8/62 (13%)
leucine-rich repeat 78..101 CDD:275380 7/30 (23%)
LRR <86..>319 CDD:227223 71/256 (28%)
LRR_8 101..159 CDD:338972 23/59 (39%)
leucine-rich repeat 102..125 CDD:275380 9/24 (38%)
leucine-rich repeat 126..149 CDD:275380 10/22 (45%)
leucine-rich repeat 150..211 CDD:275380 17/77 (22%)
leucine-rich repeat 212..259 CDD:275380 9/51 (18%)
leucine-rich repeat 260..283 CDD:275380 5/22 (23%)
LRR_8 262..316 CDD:338972 19/53 (36%)
leucine-rich repeat 284..307 CDD:275380 10/22 (45%)
leucine-rich repeat 308..331 CDD:275380 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45836
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.