DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Best4 and nr3c1

DIOPT Version :9

Sequence 1:NP_001097609.1 Gene:Best4 / 39660 FlyBaseID:FBgn0036491 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001016967.1 Gene:nr3c1 / 549721 XenbaseID:XB-GENE-484757 Length:778 Species:Xenopus tropicalis


Alignment Length:243 Identity:43/243 - (17%)
Similarity:78/243 - (32%) Gaps:86/243 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 PAASTAYMESQSKLQKRHESAMSTLSTRSRNNFRQN------------FLGRPSATGSYSDSIQM 414
            |.::.:...::.:.|...:.|::..||...||..|.            ::|.|...|..:|....
 Frog    49 PTSTASQSNTRQQQQFLKQKAVTGDSTNGLNNVPQPDLSKAVSLSMGLYMGEPDTKGMGNDIAFP 113

  Fly   415 EDGPSRVTFSENQF---------------------DLPHD------EANSSHKPSQSTIDFNDLI 452
            ....:.::..|..|                     ::|.|      :.::..:||        ::
 Frog   114 PQEQTGISTGETDFSLLEESIASLQATTLPPDRLLEMPEDPGVLKCDVSAQPRPS--------ML 170

  Fly   453 EQRRRERRERIRHRFLDMQSTHLRHD--------TSGA--PY---------TITVLRP-PSDET- 496
            .|........|:....|..:..|..|        |.|.  |:         ..::|.| .:|:| 
 Frog   171 GQGGSNGNSTIKLSLTDQSTFDLLQDLDIPPDSPTGGKRNPWLDPLFDEEEAFSLLTPLATDDTF 235

  Fly   497 ------LSES----------QEAGDRAQQDPSGSKEPPPN--KTEKQD 526
                  ||||          .:..|||::....:...|..  ||||:|
 Frog   236 LMKSEVLSESSKPLGLEDSTHKLSDRAKEGLLSTAALPVTQVKTEKED 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Best4NP_001097609.1 Bestrophin 8..319 CDD:279411
nr3c1NP_001016967.1 GCR 29..403 CDD:366943 43/243 (18%)
NR_DBD_GR_PR 420..495 CDD:143546
NR_LBD_GR 532..778 CDD:132761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165173179
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.