DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Best4 and sp7

DIOPT Version :9

Sequence 1:NP_001097609.1 Gene:Best4 / 39660 FlyBaseID:FBgn0036491 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001128590.1 Gene:sp7 / 100189548 XenbaseID:XB-GENE-954330 Length:427 Species:Xenopus tropicalis


Alignment Length:72 Identity:15/72 - (20%)
Similarity:21/72 - (29%) Gaps:31/72 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SYCEKNGSLIPLSFVLGFFVRIVMNR-------------------------WWDQYTTIPW---- 103
            |.|::..||.|...|...:..:.|..                         |||.:....|    
 Frog   102 SGCQEPKSLSPAECVPSVYTSLDMGHPYGSWYKTGIHHPSLSSSPPGSGGSWWDMHPNTNWLGNQ 166

  Fly   104 --PDGIA 108
              |||:|
 Frog   167 SQPDGLA 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Best4NP_001097609.1 Bestrophin 8..319 CDD:279411 15/72 (21%)
sp7NP_001128590.1 C2H2 Zn finger 296..315 CDD:275368
zf-H2C2_2 307..334 CDD:372612
C2H2 Zn finger 323..345 CDD:275368
zf-H2C2_2 337..362 CDD:372612
C2H2 Zn finger 353..373 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3547
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.