powered by:
Protein Alignment Best4 and sp7
DIOPT Version :9
Sequence 1: | NP_001097609.1 |
Gene: | Best4 / 39660 |
FlyBaseID: | FBgn0036491 |
Length: | 526 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001128590.1 |
Gene: | sp7 / 100189548 |
XenbaseID: | XB-GENE-954330 |
Length: | 427 |
Species: | Xenopus tropicalis |
Alignment Length: | 72 |
Identity: | 15/72 - (20%) |
Similarity: | 21/72 - (29%) |
Gaps: | 31/72 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 SYCEKNGSLIPLSFVLGFFVRIVMNR-------------------------WWDQYTTIPW---- 103
|.|::..||.|...|...:..:.|.. |||.:....|
Frog 102 SGCQEPKSLSPAECVPSVYTSLDMGHPYGSWYKTGIHHPSLSSSPPGSGGSWWDMHPNTNWLGNQ 166
Fly 104 --PDGIA 108
|||:|
Frog 167 SQPDGLA 173
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3547 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
2 | 1.860 |
|
Return to query results.
Submit another query.