DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and HT1

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_176430.2 Gene:HT1 / 842538 AraportID:AT1G62400 Length:390 Species:Arabidopsis thaliana


Alignment Length:280 Identity:90/280 - (32%)
Similarity:141/280 - (50%) Gaps:33/280 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DFSEITLREKVGHGSYGVVCKAVWRDKLVAVK---------EFFASAEQKDIEKEVKQLSRVKHP 70
            |.|::.:..|...|::..:.:.:::.:.||||         |..|..||: .:.||..|||:.||
plant    82 DLSQLFIGNKFASGAHSRIYRGIYKQRAVAVKMVRIPTHKEETRAKLEQQ-FKSEVALLSRLFHP 145

  Fly    71 NIIALHGISSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKP 135
            ||:.............:|.|:...|:|..:|:.|...:.|:...:..|...:.|:.|||:   :.
plant   146 NIVQFIAACKKPPVYCIITEYMSQGNLRMYLNKKEPYSLSIETVLRLALDISRGMEYLHS---QG 207

  Fly   136 LIHRDVKPLNLLLTNKGRNLKICDFGTVADKSTMMT------NNRGSAAWMAPEVFEGSKYTEKC 194
            :||||:|..||||.::.| :|:.||||    |.:.|      .|.|:..|||||:.:...||.|.
plant   208 VIHRDLKSNNLLLNDEMR-VKVADFGT----SCLETQCREAKGNMGTYRWMAPEMIKEKPYTRKV 267

  Fly   195 DIFSWAIVLWEVLSRKQPFKG---IDNAYTIQWKIYKGERPPLLTTCPKRIEDLMTACWKTVPED 256
            |::|:.|||||:.:...||:|   :..|:.:   ..|.|||||..:|...:..|:..||...|..
plant   268 DVYSFGIVLWELTTALLPFQGMTPVQAAFAV---AEKNERPPLPASCQPALAHLIKRCWSENPSK 329

  Fly   257 RPSMQYIVGVMH---EIVKD 273
            ||....||.|:.   |.||:
plant   330 RPDFSNIVAVLEKYDECVKE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 82/262 (31%)
STKc_TAK1 25..275 CDD:270960 87/270 (32%)
HT1NP_176430.2 STKc_MAP3K-like 93..340 CDD:270901 83/258 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.