DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and AT1G53430

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_001319214.1 Gene:AT1G53430 / 841778 AraportID:AT1G53430 Length:1038 Species:Arabidopsis thaliana


Alignment Length:344 Identity:97/344 - (28%)
Similarity:161/344 - (46%) Gaps:64/344 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVGHGSYGVVCKAVWRDKL-VAVKEFFASAEQ--KDIEKEVKQLSRVKHPNIIALHGISSYQQAT 85
            |:|.|.:|.|.|.|..|.: :|||:..:.::|  ::...|:..:|.::|||::.|:|.....:..
plant   674 KIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKEL 738

  Fly    86 YLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQ---C---AEGLAYLHAMTPKPLIHRDVKPL 144
            .|:.|:.|..||...|.|..|....|    .|:.:   |   |:||||||..:...::|||:|..
plant   739 LLVYEYLENNSLARALFGTEKQRLHL----DWSTRNKICIGIAKGLAYLHEESRLKIVHRDIKAT 799

  Fly   145 NLLLTNKGRNLKICDFGTVA---DKST-MMTNNRGSAAWMAPEVFEGSKYTEKCDIFSWAIVLWE 205
            |:|| :...|.||.|||...   |::| :.|...|:..:||||.......|:|.|::|:.:|..|
plant   800 NVLL-DLSLNAKISDFGLAKLNDDENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLE 863

  Fly   206 VLSRK-----QPFKGIDNAYTIQWKIYKGER--------PPLLTTCPK----RIEDLMTACWKTV 253
            ::|.|     :|.:  :..|.:.|.....|:        |.|.|:..|    |:.::...|....
plant   864 IVSGKSNTNYRPKE--EFVYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPS 926

  Fly   254 PEDRPSMQYIVGVMHEIVK----------DYTGAD----KALEYTFVNQQIVTKESDGTVAA--- 301
            |..||.|..:|.::...:|          |.:|:.    ||||       :::::|:..|:.   
plant   927 PTLRPPMSSVVSMLEGKIKVQPPLVKREADPSGSAAMRFKALE-------LLSQDSESQVSTYAR 984

  Fly   302 ---QPDSLSSQEGELSPSS 317
               |..|.||.:|....||
plant   985 NREQDISSSSMDGPWVDSS 1003

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 80/269 (30%)
STKc_TAK1 25..275 CDD:270960 82/289 (28%)
AT1G53430NP_001319214.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.