DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and VIK

DIOPT Version :10

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_172853.1 Gene:VIK / 837960 AraportID:AT1G14000 Length:438 Species:Arabidopsis thaliana


Alignment Length:276 Identity:94/276 - (34%)
Similarity:142/276 - (51%) Gaps:21/276 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LQAAYVDFSEITLREKVGHGSYGVVCKAVWRDKLVAVKEFFASAEQ-----KDIEKEVKQLSRVK 68
            ::.|.:|||...:   :|.||:|.:.||.||...||||....|...     :|...||..|.:::
plant   155 IEPAELDFSNAAM---IGKGSFGEIVKAYWRGTPVAVKRILPSLSDDRLVIQDFRHEVDLLVKLR 216

  Fly    69 HPNIIALHGISSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTP 133
            ||||:...|..:.::...||.|:..||.||.:|  |.|...:...|:::|...|.|:.||| ..|
plant   217 HPNIVQFLGAVTERKPLMLITEYLRGGDLHQYL--KEKGGLTPTTAVNFALDIARGMTYLH-NEP 278

  Fly   134 KPLIHRDVKPLNLLLTNKGR-NLKICDFG-----TVADKSTM--MTNNRGSAAWMAPEVFEGSKY 190
            ..:||||:||.|:||.|... :||:.|||     .|.:...:  ||...||..:||||||:..:|
plant   279 NVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLIKVQNSHDVYKMTGETGSYRYMAPEVFKHRRY 343

  Fly   191 TEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPLLTT-CPKRIEDLMTACWKTVP 254
            .:|.|:||:|::|:|:|..:.||.. ...|.....:..|.||...:. |...:.:|:..||....
plant   344 DKKVDVFSFAMILYEMLEGEPPFAN-HEPYEAAKHVSDGHRPTFRSKGCTPDLRELIVKCWDADM 407

  Fly   255 EDRPSMQYIVGVMHEI 270
            ..|||...|:..:.:|
plant   408 NQRPSFLDILKRLEKI 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 STKc_TAK1 25..275 CDD:270960 90/260 (35%)
VIKNP_172853.1 ANK repeat 36..68 CDD:293786
ANKYR <38..>127 CDD:440430
ANK repeat 70..101 CDD:293786
ANK repeat 103..127 CDD:293786
STKc_MAP3K-like 168..420 CDD:270901 89/255 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.