DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and AT5G66710

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_201472.1 Gene:AT5G66710 / 836804 AraportID:AT5G66710 Length:405 Species:Arabidopsis thaliana


Alignment Length:378 Identity:106/378 - (28%)
Similarity:177/378 - (46%) Gaps:71/378 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VDFSEITLREKVGHGSYGVVCKAVWRDKL-VAVKEF-------FASAEQKDIEKEVKQLSRVKHP 70
            ||..:|::.:.:|.||...|.:.::|..: |:||.|       .:..::|..::||..||:.:|.
plant    66 VDVKDISIGDFIGEGSSSTVYRGLFRRVVPVSVKIFQPKRTSALSIEQRKKFQREVLLLSKFRHE 130

  Fly    71 NIIALHGISSYQQATYLIMEFAEGGSLHNF-LHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPK 134
            ||:...| :..:....:|.|..||.:|..| |..:.|| ..|..::|:|...|.|:.:|:|   .
plant   131 NIVRFIG-ACIEPKLMIITELMEGNTLQKFMLSVRPKP-LDLKLSISFALDIARGMEFLNA---N 190

  Fly   135 PLIHRDVKPLNLLLTNKGRNLKICDFGTVADKST-MMTNNRGSAAWMAPEVF--------EGSKY 190
            .:||||:||.|:|||...:::|:.|||...:::. .||...|:..|||||:|        |...|
plant   191 GIIHRDLKPSNMLLTGDQKHVKLADFGLAREETKGFMTFEAGTYRWMAPELFSYDTLEIGEKKHY 255

  Fly   191 TEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPLLTTCPKRIEDLMTACWKTVPE 255
            ..|.|::|:|||.||:|:.|.||||.:|.: :.:...|.:||. :...|:.:..::.:||...|:
plant   256 DHKVDVYSFAIVFWELLTNKTPFKGKNNIF-VAYAASKNQRPS-VENLPEGVVSILQSCWAENPD 318

  Fly   256 DRPSMQYIVGVMHEIVKDYTGADKALEYTFVNQQIVTKESDGTVAAQPDSLSSQEGELSPSSTQL 320
            .||..                  |.:.|:..|..              .||||.           
plant   319 ARPEF------------------KEITYSLTNLL--------------RSLSSD----------- 340

  Fly   321 TPTTAANANVNAIAISKTTTSSMTENTSSTSSDITPTNSGQL--DNNPLFYMV 371
            |..|::|:..| ||...:|:|.:.|........:..:.:.:|  ..|.|..|:
plant   341 TDATSSNSKAN-IATEDSTSSLVQERVVCDCPGLKMSKTKKLKKKTNKLMNMI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 84/262 (32%)
STKc_TAK1 25..275 CDD:270960 83/267 (31%)
AT5G66710NP_201472.1 STYKc 71..326 CDD:214568 85/279 (30%)
STKc_MAP3K-like 77..330 CDD:270901 85/277 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 140 1.000 Domainoid score I1532
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D635654at2759
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.