DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and AT5G60270

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_200835.1 Gene:AT5G60270 / 836149 AraportID:AT5G60270 Length:668 Species:Arabidopsis thaliana


Alignment Length:352 Identity:89/352 - (25%)
Similarity:146/352 - (41%) Gaps:67/352 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EKVGHGSYGVVCKAVW---RD-KLVAVKEFFASAE--QKDIEKEVKQLSRVKHPNIIALHGISSY 81
            |.:|.|.:|.|.|...   |: :.||||......|  .|....|:..:..:||.:::.|.|....
plant   345 EFLGRGGFGEVYKGTLPRSRELREVAVKRVSHDGEHGMKQFVAEIVSMRSLKHRSLVPLLGYCRR 409

  Fly    82 QQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKPLIHRDVKPLNL 146
            :....|:.|:...|||.::|....:.:......::..|..|..|:|||....:.:||||:|..|:
plant   410 KHELLLVSEYMPNGSLDHYLFNHDRLSLPWWRRLAILRDIASALSYLHTEADQVVIHRDIKAANV 474

  Fly   147 LLTNKGRNLKICDFGTV------ADKSTMMTNNRGSAAWMAPEVFEGSKYTEKCDIFSWAIVLWE 205
            :| :...|.::.|||..      ||.||  |...|:..:||||:......| ..|::::.:.|.|
plant   475 ML-DAEFNGRLGDFGMSRLYDRGADPST--TAAVGTVGYMAPELTTMGAST-GTDVYAFGVFLLE 535

  Fly   206 VLSRKQPFK-GIDNA--YTIQW--KIYK-----GERPPLLTTCP----KRIEDLMTACWKTVPED 256
            |...::|.: |:..|  :.|:|  :.:|     ..|.|.||...    :::..|...|....|:.
plant   536 VTCGRRPVEPGLPEAKRFLIKWVSECWKRSSLIDARDPRLTEFSSQEVEKVLKLGLLCANLAPDS 600

  Fly   257 RPSMQYIVGVMHEIVKDYTGADKALEYTFVNQQIVTKESDGTVAAQPDSLSSQEGELSPSSTQLT 321
            ||:|:.:|        .|...:.||...:.|       |.|.            |.|||.:....
plant   601 RPAMEQVV--------QYLNGNLALPEFWPN-------SPGI------------GVLSPMALSPA 638

  Fly   322 PTTAANANVNAIAISKTTTSSMTENTS 348
            |          :.|...:.||.:.|.|
plant   639 P----------LVIPSLSFSSSSSNNS 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 72/266 (27%)
STKc_TAK1 25..275 CDD:270960 72/275 (26%)
AT5G60270NP_200835.1 Lectin_legB 26..271 CDD:365899
PKc_like 347..613 CDD:389743 73/277 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.