DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and AT5G50180

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_199829.1 Gene:AT5G50180 / 835083 AraportID:AT5G50180 Length:346 Species:Arabidopsis thaliana


Alignment Length:321 Identity:93/321 - (28%)
Similarity:157/321 - (48%) Gaps:45/321 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVGHGSYGVVCKAVWRDKLVAVKEFFASAEQKDIEK-------EVKQLSRVKHPNIIALHGISSY 81
            |:|.|::..|.:..::::.||:|........::|.|       ||:.||||:|.|::...| :..
plant    25 KIGEGAHAKVYEGKYKNQTVAIKIVHRGETPEEIAKRDSRFLREVEMLSRVQHKNLVKFIG-ACK 88

  Fly    82 QQATYLIMEFAEGGSLHNFLHGKVKPA-YSLAHAMSWARQCAEGLAYLHAMTPKPLIHRDVKPLN 145
            :....::.|..:||:|..:|. .::|| .....|:.:|...|.|:..||:   ..:||||:||.|
plant    89 EPVMVIVTELLQGGTLRKYLL-NLRPACLETRVAIGFALDIARGMECLHS---HGIIHRDLKPEN 149

  Fly   146 LLLTNKGRNLKICDFGTVADKS--TMMTNNRGSAAWMAPEVF--------EGSKYTEKCDIFSWA 200
            ||||...:.:|:.|||...::|  .|||...|:..|||||::        |...|..|.|.:|:|
plant   150 LLLTADHKTVKLADFGLAREESLTEMMTAETGTYRWMAPELYSTVTLRLGEKKHYNHKVDAYSFA 214

  Fly   201 IVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPLLTTCPKRIEDLMTACWKTVPEDRPSMQYIVG 265
            |||||:|..|.||:|:.|........:|..||. ..:.|:.:.|::|:||...|..||:..:|: 
plant   215 IVLWELLHNKLPFEGMSNLQAAYAAAFKNVRPS-AESLPEELGDIVTSCWNEDPNARPNFTHII- 277

  Fly   266 VMHEIVKDYTGADKALEYTFVNQQIVTKESDGTVAAQPDSLSSQEGELSPSSTQLTPTTAA 326
               |::.:|                 ..:....::|.|..:.:.:..|.|..:..|.:..|
plant   278 ---ELLLNY-----------------LSKVGSPISAIPQRILASKNTLLPPDSPGTSSLMA 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 84/257 (33%)
STKc_TAK1 25..275 CDD:270960 85/267 (32%)
AT5G50180NP_199829.1 STKc_MAP3K-like 26..280 CDD:270901 85/263 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 140 1.000 Domainoid score I1532
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.