DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and AT5G41730

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_001330018.1 Gene:AT5G41730 / 834176 AraportID:AT5G41730 Length:711 Species:Arabidopsis thaliana


Alignment Length:503 Identity:114/503 - (22%)
Similarity:183/503 - (36%) Gaps:95/503 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 WRDKLVAVKEFFASAEQKDIEKEVKQLSRVKHPNIIA-LHGI-SSYQQATYLIMEFAEGGSLHNF 100
            |.....|::.||:..|  .:..|:..|..:.|.||:. |.|. ...::..:|:||.     :|..
plant   257 WLGDSFALRHFFSDLE--PLSSEISSLLALCHSNILQYLCGFYDEERKECFLVMEL-----MHKD 314

  Fly   101 LHGKVKP--------AYSLAHAMSWARQCAEGLAYLHAMTPKPLIHRDVKPLNLLLTNKGR---- 153
            |...:|.        .:|:...:....|.|.|:.|||.   ..:.|.|:.|:|:.|..:..    
plant   315 LQSYMKENCGPRRRYLFSIPVVIDIMLQIARGMEYLHG---NDIFHGDLNPMNIHLKERSHTEGY 376

  Fly   154 -NLKICDFG---TVADKSTMMTNNRGSAAWMAPEVF-----------EGSKYTEKCDIFSWAIVL 203
             :.|||.||   .|..:|:..........|.||||.           ..||.|.|.|::|:|:|.
plant   377 FHAKICGFGLSSVVKAQSSSKPGTPDPVIWYAPEVLAEMEQDLNGKTPKSKLTHKADVYSFAMVC 441

  Fly   204 WEVLSRKQPFKGI---DNAYTIQWKIYKGERPPLLTTCPKRIEDLMTACWKTVPEDRPSMQYIVG 265
            :|:::.|.||:..   ....||  .|..||||......||.:..|:..||.:.|..||:...|..
plant   442 FELITGKVPFEDSHLQGEPMTI--NIRMGERPLFPFPSPKYLVSLIKRCWHSEPSQRPNFSSICR 504

  Fly   266 VMHEIVKDYTGADKALEYTFVNQQIVTKESDGTVAAQPDSLSSQEGELSPSSTQLTPTTAAN--A 328
            ::.                ::.:.:|.....|....|...:..  .:|.....:..|..|.:  |
plant   505 ILR----------------YIKKFLVVNPDHGHPQMQTPLVDC--WDLEARFLRKFPGDAGSHTA 551

  Fly   329 NVNAIAIS----KTTTSSMTENTSSTSSDITPTNSGQLDNNPLFYMVTNR-----WDAIPEEESN 384
            :||.|...    :..........|..||:.:.:.|..:..:|...|:|..     .|.|.|....
plant   552 SVNQIPFQLYSYRVLEKEKMNPNSKESSETSESESVSVVEDPPNAMITRDTKSLCLDTISEYSDT 616

  Fly   385 ES--RNDSFNLTSSAEATQRLETIRNGMILMACKPMEQLTLDVEANGF-DLSPSESSSSSTNAKS 446
            .|  ........|:.:.:..:..:|....|.:.|.....|..|:|... .:||......|..|:.
plant   617 RSVYSEAPMKKVSALKKSGEMAKLRRSPSLGSEKLRSAGTSTVKARSSPKVSPLSPFGRSIKARK 681

  Fly   447 DGRERLTVTDTKPVMMTTDLSNNNGGIHAHSNGLLSHANGWQARDEEL 494
            |  .||.::...|:         ..||.....|   ||:     |.||
plant   682 D--NRLPLSPMSPL---------TPGIRRQQTG---HAS-----DSEL 710

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 69/257 (27%)
STKc_TAK1 25..275 CDD:270960 70/268 (26%)
AT5G41730NP_001330018.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23257
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.