DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and AT5G40540

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_198870.1 Gene:AT5G40540 / 834052 AraportID:AT5G40540 Length:353 Species:Arabidopsis thaliana


Alignment Length:333 Identity:94/333 - (28%)
Similarity:162/333 - (48%) Gaps:36/333 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VDFSEITLREKVGHGSYGVVCKAVWRDKLVAVK--------EFFASAEQKDIEKEVKQLSRVKHP 70
            ||...:.:..|:|.|::..:.:..:::|.||:|        |..|..|.: ..:||..||||:|.
plant    21 VDPQHLFVGPKIGEGAHAKIYEGKYKNKTVAIKIVKRGESPEEIAKRESR-FAREVSMLSRVQHK 84

  Fly    71 NIIALHGISSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKP 135
            |::...| :..:....::.|...||:|..:|......:..:..|:.:|...|..:..||:   ..
plant    85 NLVKFIG-ACKEPIMVIVTELLLGGTLRKYLVSLRPGSLDIRVAVGYALDIARAMECLHS---HG 145

  Fly   136 LIHRDVKPLNLLLTNKGRNLKICDFGTVADKS--TMMTNNRGSAAWMAPEVF--------EGSKY 190
            :||||:||.:|:||...:.:|:.|||...::|  .|||...|:..|||||::        |...|
plant   146 VIHRDLKPESLILTADYKTVKLADFGLAREESLTEMMTAETGTYRWMAPELYSTVTLRHGEKKHY 210

  Fly   191 TEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPLLTTCPKRIEDLMTACWKTVPE 255
            ..|.|.:|:||||||::..|.||:|:.|........:|..||. ....||.:..::|:|||..|.
plant   211 NHKVDAYSFAIVLWELIHNKLPFEGMSNLQAAYAAAFKNVRPS-ADDLPKDLAMIVTSCWKEDPN 274

  Fly   256 DRPSMQYIVGVMHEIVKDYTGAD---KALEYTFVNQQ-IVTKESDGTVAAQ--------PDSLSS 308
            |||:...|:.::...:...:..:   .|::..|.::. ::..||.||.:..        |...:|
plant   275 DRPNFTEIIQMLLRCLSTISSTELVPPAIKRVFSSENTVLPPESPGTCSLMTVRDKDQIPTDANS 339

  Fly   309 QEGELSPS 316
            .:.|:..|
plant   340 AQNEVRGS 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 81/262 (31%)
STKc_TAK1 25..275 CDD:270960 81/267 (30%)
AT5G40540NP_198870.1 STKc_MAP3K-like 32..286 CDD:270901 81/259 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 140 1.000 Domainoid score I1532
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.