DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and AT5G01850

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_001332324.1 Gene:AT5G01850 / 831760 AraportID:AT5G01850 Length:357 Species:Arabidopsis thaliana


Alignment Length:371 Identity:102/371 - (27%)
Similarity:167/371 - (45%) Gaps:89/371 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QAAYVDFSEITLREKVGHGSYGVVCKAVWRDKLVAVKEFFASA---EQKDIE----KEVKQLSRV 67
            ::..||...:.:..|:|.|::|.|.:..:..::||:|.....:   :|..:|    :||..:|||
plant     9 ESLLVDPKLLFIGSKIGEGAHGKVYQGRYGRQIVAIKVVNRGSKPDQQSSLESRFVREVNMMSRV 73

  Fly    68 KHPNIIAL----------------HGISSYQ-------QATYLIMEFAEGGSLHNFLHGKVKPAY 109
            :|.|::.:                :.||.:|       ....::.|...|.||..:| ..::|  
plant    74 QHHNLVKVSLLLSSLSLLSILLLEYTISIWQFIGACKDPLMVIVTELLPGMSLRKYL-TSIRP-- 135

  Fly   110 SLAH---AMSWARQCAEGLAYLHAMTPKPLIHRDVKPLNLLLTNKGRNLKICDFGTVADKST--M 169
            .|.|   |:|:|...|..|..|||   ..:||||:||.|||||...:::|:.|||...::|.  |
plant   136 QLLHLPLALSFALDIARALHCLHA---NGIIHRDLKPDNLLLTENHKSVKLADFGLAREESVTEM 197

  Fly   170 MTNNRGSAAWMAPEVF------EGSK--YTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKI 226
            ||...|:..|||||::      :|.|  |..|.|::|:.|||||:|:.:.||:|:.|........
plant   198 MTAETGTYRWMAPELYSTVTLRQGEKKHYNNKVDVYSFGIVLWELLTNRMPFEGMSNLQAAYAAA 262

  Fly   227 YKGERPPLLTTCPKRIEDLMTACWKTVPEDRPSMQYIVGVMHEIVKDYTGADKALEYTFVNQQIV 291
            :|.|||.:.......:..::.:||...|..|||...|:.:::|.                   ::
plant   263 FKQERPVMPEGISPSLAFIVQSCWVEDPNMRPSFSQIIRLLNEF-------------------LL 308

  Fly   292 TKESDGTVAAQPDSLSSQEGELSPSSTQLTPTTAANANVNAIAISK 337
            |                    |:|...|..|.||.| ..|..||::
plant   309 T--------------------LTPPPPQPLPETATN-RTNGRAITE 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 87/287 (30%)
STKc_TAK1 25..275 CDD:270960 88/292 (30%)
AT5G01850NP_001332324.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 140 1.000 Domainoid score I1532
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.