DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and PERK5

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_001320136.1 Gene:PERK5 / 829595 AraportID:AT4G34440 Length:670 Species:Arabidopsis thaliana


Alignment Length:415 Identity:111/415 - (26%)
Similarity:167/415 - (40%) Gaps:94/415 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ATASLDALQAAYVDFSEITLREKVGHGSYGVVCKAVW-RDKLVAVKEFFASAEQ--KDIEKEVKQ 63
            :|.:.|.|..|...|::..|   :|.|.:|.|.|.|. ..|.||||.....:.|  ::.:.||..
plant   298 STFTYDELSIATEGFAQSNL---LGQGGFGYVHKGVLPSGKEVAVKSLKLGSGQGEREFQAEVDI 359

  Fly    64 LSRVKHPNIIALHG--ISSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLA 126
            :|||.|.::::|.|  ||..|:  .|:.||....:|...||||.:|.......:..|...|.|||
plant   360 ISRVHHRHLVSLVGYCISGGQR--LLVYEFIPNNTLEFHLHGKGRPVLDWPTRVKIALGSARGLA 422

  Fly   127 YLHAMTPKPLIHRDVKPLNLLLTNKGRNLKICDFGTV---ADKST-MMTNNRGSAAWMAPEVFEG 187
            |||......:||||:|..|:|| :.....|:.|||..   .|..| :.|...|:..::|||....
plant   423 YLHEDCHPRIIHRDIKAANILL-DFSFETKVADFGLAKLSQDNYTHVSTRVMGTFGYLAPEYASS 486

  Fly   188 SKYTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPLLTTCPKRIEDLMTACWKT 252
            .|.::|.|:||:.::|.|:::.:.|   :|....::..:....||    .|.|..:|        
plant   487 GKLSDKSDVFSFGVMLLELITGRPP---LDLTGEMEDSLVDWARP----LCLKAAQD-------- 536

  Fly   253 VPEDRPSMQYIVGVMHEIVKDYTG-ADKALEYTFVNQQIVTKESDGTVAAQ-------------- 302
                               .||.. ||..||..:.:|::|...|....|.:              
plant   537 -------------------GDYNQLADPRLELNYSHQEMVQMASCAAAAIRHSARRRPKMSQIVR 582

  Fly   303 -------PDSLSSQEGELSPSSTQLTP-----------TTAANANVNAIAISKTT--------TS 341
                   .|.||  ||.....||.|:|           .||.......:|:....        ||
plant   583 ALEGDMSMDDLS--EGTRPGQSTYLSPGSVSSEYDASSYTADMKKFKKLALENKEYQSSEYGGTS 645

  Fly   342 SMTENTSSTSSDITPTNSGQLDNNP 366
            ....|.|::||:  ..|.|.:..||
plant   646 EYGLNPSASSSE--EMNRGSMKRNP 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 74/253 (29%)
STKc_TAK1 25..275 CDD:270960 74/258 (29%)
PERK5NP_001320136.1 PKc_like 318..587 CDD:419665 83/305 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.